Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   SC10_RS17045 Genome accession   NZ_CP010524
Coordinates   3420153..3420293 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain BL-09     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3415153..3425293
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SC10_RS17020 (SC10_B2orf05134) - 3415446..3415835 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  SC10_RS17025 (SC10_B2orf05136) comA 3415852..3416490 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  SC10_RS17030 (SC10_B2orf05137) comP 3416577..3418892 (-) 2316 WP_020452789.1 sensor histidine kinase Regulator
  SC10_RS17035 (SC10_B2orf05138) comX 3418913..3419083 (-) 171 WP_020452790.1 competence pheromone ComX -
  SC10_RS17040 (SC10_B2orf05139) - 3419055..3419966 (-) 912 WP_035337591.1 polyprenyl synthetase family protein -
  SC10_RS17045 (SC10_B2orf05140) degQ 3420153..3420293 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  SC10_RS17050 (SC10_B2orf05142) - 3420905..3421126 (+) 222 WP_230368259.1 hypothetical protein -
  SC10_RS17055 (SC10_B2orf05143) - 3421169..3422389 (-) 1221 WP_035337594.1 EAL and HDOD domain-containing protein -
  SC10_RS17060 (SC10_B2orf05144) - 3422567..3424036 (-) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  SC10_RS17065 (SC10_B2orf05145) - 3424054..3424605 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  SC10_RS17070 (SC10_B2orf05147) - 3424791..3425192 (-) 402 WP_026580054.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=138990 SC10_RS17045 WP_003184860.1 3420153..3420293(-) (degQ) [Bacillus paralicheniformis strain BL-09]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=138990 SC10_RS17045 WP_003184860.1 3420153..3420293(-) (degQ) [Bacillus paralicheniformis strain BL-09]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment