Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   OB04_RS12585 Genome accession   NZ_CP009796
Coordinates   2436035..2436418 (-) Length   127 a.a.
NCBI ID   WP_038429292.1    Uniprot ID   -
Organism   Bacillus subtilis strain SG6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2431035..2441418
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OB04_RS12545 (OB04_02458) sinI 2431969..2432142 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OB04_RS12550 (OB04_02459) sinR 2432176..2432511 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OB04_RS12555 (OB04_02460) tasA 2432604..2433389 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  OB04_RS12560 (OB04_02461) sipW 2433453..2434025 (-) 573 WP_003230181.1 signal peptidase I SipW -
  OB04_RS12565 (OB04_02462) tapA 2434009..2434770 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  OB04_RS12570 (OB04_02463) yqzG 2435042..2435368 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OB04_RS12575 (OB04_02464) spoIITA 2435410..2435589 (-) 180 WP_014480252.1 YqzE family protein -
  OB04_RS12580 (OB04_02465) comGG 2435660..2436034 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  OB04_RS12585 comGF 2436035..2436418 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  OB04_RS12590 (OB04_02467) comGE 2436444..2436791 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  OB04_RS12595 (OB04_02468) comGD 2436775..2437206 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  OB04_RS12600 (OB04_02469) comGC 2437196..2437492 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  OB04_RS12605 (OB04_02470) comGB 2437506..2438543 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  OB04_RS12610 (OB04_02471) comGA 2438530..2439600 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  OB04_RS12625 (OB04_02474) corA 2440012..2440965 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14547.68 Da        Isoelectric Point: 6.4849

>NTDB_id=132339 OB04_RS12585 WP_038429292.1 2436035..2436418(-) (comGF) [Bacillus subtilis strain SG6]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSRQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=132339 OB04_RS12585 WP_038429292.1 2436035..2436418(-) (comGF) [Bacillus subtilis strain SG6]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCAGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.619

99.213

0.969


Multiple sequence alignment