Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   OB04_RS12545 Genome accession   NZ_CP009796
Coordinates   2431969..2432142 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SG6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2426969..2437142
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OB04_RS12530 (OB04_02455) gcvT 2427768..2428856 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  OB04_RS12535 (OB04_02456) hepAA 2429298..2430971 (+) 1674 WP_003230203.1 SNF2-related protein -
  OB04_RS12540 (OB04_02457) yqhG 2430992..2431786 (+) 795 WP_003230200.1 YqhG family protein -
  OB04_RS12545 (OB04_02458) sinI 2431969..2432142 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OB04_RS12550 (OB04_02459) sinR 2432176..2432511 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OB04_RS12555 (OB04_02460) tasA 2432604..2433389 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  OB04_RS12560 (OB04_02461) sipW 2433453..2434025 (-) 573 WP_003230181.1 signal peptidase I SipW -
  OB04_RS12565 (OB04_02462) tapA 2434009..2434770 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  OB04_RS12570 (OB04_02463) yqzG 2435042..2435368 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OB04_RS12575 (OB04_02464) spoIITA 2435410..2435589 (-) 180 WP_014480252.1 YqzE family protein -
  OB04_RS12580 (OB04_02465) comGG 2435660..2436034 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  OB04_RS12585 comGF 2436035..2436418 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  OB04_RS12590 (OB04_02467) comGE 2436444..2436791 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=132336 OB04_RS12545 WP_003230187.1 2431969..2432142(+) (sinI) [Bacillus subtilis strain SG6]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=132336 OB04_RS12545 WP_003230187.1 2431969..2432142(+) (sinI) [Bacillus subtilis strain SG6]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment