Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NG74_RS11580 Genome accession   NZ_CP009679
Coordinates   2457873..2458046 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain JS25R     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2452873..2463046
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NG74_RS11565 (NG74_02395) gcvT 2453686..2454786 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  NG74_RS11570 (NG74_02397) - 2455210..2456880 (+) 1671 WP_038461530.1 DEAD/DEAH box helicase -
  NG74_RS11575 (NG74_02398) - 2456902..2457696 (+) 795 WP_014418368.1 YqhG family protein -
  NG74_RS11580 (NG74_02399) sinI 2457873..2458046 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  NG74_RS11585 (NG74_02400) sinR 2458080..2458415 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NG74_RS11590 (NG74_02401) tasA 2458463..2459248 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NG74_RS11595 (NG74_02402) sipW 2459313..2459897 (-) 585 WP_022552967.1 signal peptidase I SipW -
  NG74_RS11600 (NG74_02403) tapA 2459869..2460540 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  NG74_RS11605 (NG74_02404) - 2460799..2461128 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NG74_RS11610 (NG74_02405) - 2461169..2461348 (-) 180 WP_022552966.1 YqzE family protein -
  NG74_RS11615 (NG74_02406) comGG 2461405..2461782 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  NG74_RS11620 (NG74_02407) comGF 2461783..2462178 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  NG74_RS11625 (NG74_02408) comGE 2462192..2462506 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  NG74_RS11630 (NG74_02409) comGD 2462490..2462927 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=131078 NG74_RS11580 WP_014418369.1 2457873..2458046(+) (sinI) [Bacillus velezensis strain JS25R]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=131078 NG74_RS11580 WP_014418369.1 2457873..2458046(+) (sinI) [Bacillus velezensis strain JS25R]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment