Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NG74_RS11580 | Genome accession | NZ_CP009679 |
| Coordinates | 2457873..2458046 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain JS25R | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2452873..2463046
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NG74_RS11565 (NG74_02395) | gcvT | 2453686..2454786 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NG74_RS11570 (NG74_02397) | - | 2455210..2456880 (+) | 1671 | WP_038461530.1 | DEAD/DEAH box helicase | - |
| NG74_RS11575 (NG74_02398) | - | 2456902..2457696 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| NG74_RS11580 (NG74_02399) | sinI | 2457873..2458046 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| NG74_RS11585 (NG74_02400) | sinR | 2458080..2458415 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| NG74_RS11590 (NG74_02401) | tasA | 2458463..2459248 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| NG74_RS11595 (NG74_02402) | sipW | 2459313..2459897 (-) | 585 | WP_022552967.1 | signal peptidase I SipW | - |
| NG74_RS11600 (NG74_02403) | tapA | 2459869..2460540 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NG74_RS11605 (NG74_02404) | - | 2460799..2461128 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| NG74_RS11610 (NG74_02405) | - | 2461169..2461348 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| NG74_RS11615 (NG74_02406) | comGG | 2461405..2461782 (-) | 378 | WP_022552965.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NG74_RS11620 (NG74_02407) | comGF | 2461783..2462178 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| NG74_RS11625 (NG74_02408) | comGE | 2462192..2462506 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| NG74_RS11630 (NG74_02409) | comGD | 2462490..2462927 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=131078 NG74_RS11580 WP_014418369.1 2457873..2458046(+) (sinI) [Bacillus velezensis strain JS25R]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=131078 NG74_RS11580 WP_014418369.1 2457873..2458046(+) (sinI) [Bacillus velezensis strain JS25R]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |