Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   DR75_RS08395 Genome accession   NZ_CP008816
Coordinates   1581894..1582421 (-) Length   175 a.a.
NCBI ID   WP_002414633.1    Uniprot ID   -
Organism   Enterococcus faecalis ATCC 29212     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1545411..1590890 1581894..1582421 within 0


Gene organization within MGE regions


Location: 1545411..1590890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DR75_RS08150 (DR75_1482) - 1545411..1545953 (-) 543 WP_002385677.1 5-formyltetrahydrofolate cyclo-ligase -
  DR75_RS08155 (DR75_1483) - 1546041..1546811 (-) 771 WP_002356329.1 alpha/beta fold hydrolase -
  DR75_RS08160 (DR75_1484) - 1546977..1547552 (+) 576 WP_002356327.1 DUF805 domain-containing protein -
  DR75_RS08165 (DR75_1485) - 1547643..1549208 (+) 1566 WP_002399111.1 membrane protein -
  DR75_RS08170 (DR75_1486) - 1549160..1550293 (+) 1134 WP_002392337.1 DUF4950 domain-containing protein -
  DR75_RS08175 (DR75_1487) - 1550553..1551617 (-) 1065 WP_002356323.1 FUSC family protein -
  DR75_RS08180 (DR75_1488) - 1551873..1552124 (-) 252 WP_002389274.1 hypothetical protein -
  DR75_RS08195 (DR75_1491) - 1552917..1553726 (-) 810 WP_002414603.1 DUF3800 domain-containing protein -
  DR75_RS08200 (DR75_1492) - 1554122..1555360 (-) 1239 WP_002404583.1 LysM peptidoglycan-binding domain-containing protein -
  DR75_RS08205 (DR75_1493) - 1555365..1555568 (-) 204 WP_002369080.1 phage holin -
  DR75_RS08210 (DR75_1494) - 1555571..1555803 (-) 233 Protein_1463 hemolysin XhlA family protein -
  DR75_RS08215 (DR75_1495) - 1555837..1555974 (-) 138 WP_040118571.1 XkdX family protein -
  DR75_RS08220 - 1555974..1556344 (-) 371 Protein_1465 hypothetical protein -
  DR75_RS08225 (DR75_1497) - 1556359..1556883 (-) 525 WP_002414601.1 hypothetical protein -
  DR75_RS08230 (DR75_1498) - 1556883..1557200 (-) 318 WP_002369975.1 hypothetical protein -
  DR75_RS08235 (DR75_1499) - 1557193..1557510 (-) 318 WP_002414600.1 hypothetical protein -
  DR75_RS08240 (DR75_1500) - 1557503..1558411 (-) 909 WP_010784633.1 phage baseplate upper protein -
  DR75_RS08245 (DR75_1501) - 1558426..1561140 (-) 2715 WP_025193066.1 phage tail spike protein -
  DR75_RS08250 (DR75_1502) - 1561122..1561856 (-) 735 WP_002414530.1 hypothetical protein -
  DR75_RS08255 (DR75_1503) - 1561846..1564743 (-) 2898 WP_025193156.1 tape measure protein -
  DR75_RS08260 (DR75_1504) gpG 1564992..1565345 (-) 354 WP_002364485.1 phage tail assembly chaperone G -
  DR75_RS08265 (DR75_1505) - 1565398..1566240 (-) 843 WP_002414527.1 major tail protein -
  DR75_RS08270 (DR75_1506) - 1566241..1566615 (-) 375 WP_002414526.1 DUF6838 family protein -
  DR75_RS08275 (DR75_1507) - 1566619..1567017 (-) 399 WP_002402415.1 HK97 gp10 family phage protein -
  DR75_RS08280 (DR75_1508) - 1567010..1567387 (-) 378 WP_002414525.1 hypothetical protein -
  DR75_RS08285 (DR75_1509) - 1567384..1567728 (-) 345 WP_002395886.1 hypothetical protein -
  DR75_RS08290 (DR75_1510) - 1567737..1567973 (-) 237 WP_002414524.1 hypothetical protein -
  DR75_RS08295 (DR75_1511) - 1567997..1568899 (-) 903 WP_002414522.1 DUF5309 family protein -
  DR75_RS08300 (DR75_1512) - 1568913..1569539 (-) 627 WP_002414521.1 DUF4355 domain-containing protein -
  DR75_RS08305 (DR75_1513) - 1569757..1570077 (-) 321 WP_002414520.1 hypothetical protein -
  DR75_RS08310 (DR75_1514) - 1570134..1570364 (-) 231 WP_002414519.1 hypothetical protein -
  DR75_RS08315 (DR75_1515) - 1570365..1572149 (-) 1785 WP_002414518.1 hypothetical protein -
  DR75_RS08320 (DR75_1516) - 1572124..1573599 (-) 1476 WP_002414517.1 phage portal protein -
  DR75_RS08325 (DR75_1517) - 1573612..1574886 (-) 1275 WP_025193069.1 PBSX family phage terminase large subunit -
  DR75_RS08330 (DR75_1518) - 1574876..1575337 (-) 462 WP_002414515.1 terminase small subunit -
  DR75_RS08335 (DR75_1519) - 1575715..1576575 (-) 861 WP_002369895.1 hypothetical protein -
  DR75_RS08345 (DR75_1521) - 1577433..1577849 (-) 417 WP_002357362.1 ArpU family phage packaging/lysis transcriptional regulator -
  DR75_RS08350 (DR75_1522) - 1578239..1578439 (-) 201 WP_002414920.1 hypothetical protein -
  DR75_RS08360 (DR75_1523) - 1578622..1579137 (-) 516 WP_010784645.1 DUF1642 domain-containing protein -
  DR75_RS16390 (DR75_1524) - 1579134..1579271 (-) 138 WP_002414887.1 hypothetical protein -
  DR75_RS08365 (DR75_1525) - 1579271..1579603 (-) 333 WP_002414886.1 hypothetical protein -
  DR75_RS08370 (DR75_1526) - 1579604..1579984 (-) 381 WP_010784646.1 YopX family protein -
  DR75_RS08375 - 1579981..1580217 (-) 237 WP_025193072.1 hypothetical protein -
  DR75_RS08380 (DR75_1527) - 1580225..1581274 (-) 1050 WP_010784647.1 DNA cytosine methyltransferase -
  DR75_RS08385 (DR75_1528) - 1581327..1581533 (-) 207 WP_025191024.1 hypothetical protein -
  DR75_RS08390 (DR75_1529) - 1581553..1581882 (-) 330 WP_002414634.1 hypothetical protein -
  DR75_RS08395 (DR75_1530) ssb 1581894..1582421 (-) 528 WP_002414633.1 single-stranded DNA-binding protein Machinery gene
  DR75_RS08400 (DR75_1531) - 1582426..1583277 (-) 852 WP_002365159.1 helix-turn-helix domain-containing protein -
  DR75_RS08405 (DR75_1532) - 1583281..1583922 (-) 642 WP_002414632.1 putative HNHc nuclease -
  DR75_RS08410 (DR75_1533) - 1583927..1584943 (-) 1017 WP_002365157.1 AAA family ATPase -
  DR75_RS08415 (DR75_1534) - 1584955..1585434 (-) 480 WP_002381628.1 siphovirus Gp157 family protein -
  DR75_RS16700 (DR75_1535) - 1585418..1585540 (-) 123 WP_002414628.1 hypothetical protein -
  DR75_RS16395 (DR75_1537) - 1585739..1585912 (-) 174 WP_002414625.1 hypothetical protein -
  DR75_RS08430 (DR75_1538) - 1585924..1586109 (-) 186 WP_002364665.1 hypothetical protein -
  DR75_RS08435 (DR75_1539) - 1586120..1586830 (-) 711 WP_002414624.1 phage regulatory protein -
  DR75_RS08440 (DR75_1540) - 1586912..1587181 (-) 270 WP_002414623.1 hypothetical protein -
  DR75_RS08445 (DR75_1541) - 1587196..1587390 (-) 195 WP_002414622.1 helix-turn-helix transcriptional regulator -
  DR75_RS08450 (DR75_1542) - 1587635..1587982 (+) 348 WP_002401993.1 helix-turn-helix domain-containing protein -
  DR75_RS08455 (DR75_1543) - 1588002..1588421 (+) 420 WP_370617577.1 ImmA/IrrE family metallo-endopeptidase -
  DR75_RS16585 (DR75_1544) - 1588511..1588690 (+) 180 WP_235207911.1 hypothetical protein -
  DR75_RS08460 - 1588702..1589244 (+) 543 WP_235207918.1 DUF4950 domain-containing protein -
  DR75_RS08465 (DR75_1546) - 1589257..1589586 (+) 330 WP_002414620.1 hypothetical protein -
  DR75_RS08470 (DR75_1547) - 1589709..1590890 (+) 1182 WP_033072557.1 site-specific integrase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19383.25 Da        Isoelectric Point: 4.5778

>NTDB_id=124463 DR75_RS08395 WP_002414633.1 1581894..1582421(-) (ssb) [Enterococcus faecalis ATCC 29212]
MINQVVLVGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVICESFQLLEPKSANENRNSIQTSQNDGTSVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=124463 DR75_RS08395 WP_002414633.1 1581894..1582421(-) (ssb) [Enterococcus faecalis ATCC 29212]
ATGATAAACCAAGTTGTGTTAGTTGGACGTTTAACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTATTTGCGAGAGTTTCCAATTATTAGAGCCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGACGTCACAGAATGACGGTACAAGCGTTCAAAACAATTTCGAGAGTAATTATG
CCACAAATCAAAATAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGCGCAGGTAATTCAATCGACATTAGCGACGATGATCTGCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.551

100

0.606
  ssbA Bacillus subtilis subsp. subtilis str. 168

57.143

100

0.571
  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

60.571

0.366

Multiple sequence alignment