Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   BSUB_RS17215 Genome accession   NZ_CP008698
Coordinates   3233891..3234058 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis str. AG1839     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3228891..3239058
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSUB_RS17185 (BSUB_03383) mrpE 3229286..3229762 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  BSUB_RS17190 (BSUB_03384) mrpF 3229762..3230046 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  BSUB_RS17195 (BSUB_03385) mnhG 3230030..3230404 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  BSUB_RS17200 (BSUB_03386) yuxO 3230443..3230823 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  BSUB_RS17205 (BSUB_03387) comA 3230842..3231486 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSUB_RS17210 (BSUB_03388) comP 3231567..3233876 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  BSUB_RS17215 (BSUB_03389) comX 3233891..3234058 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  BSUB_RS17220 (BSUB_03390) comQ 3234046..3234945 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  BSUB_RS17225 (BSUB_03391) degQ 3235130..3235270 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSUB_RS22975 - 3235492..3235617 (+) 126 WP_003228793.1 hypothetical protein -
  BSUB_RS17230 (BSUB_03392) - 3235731..3236099 (+) 369 WP_003243784.1 hypothetical protein -
  BSUB_RS17235 (BSUB_03393) pdeH 3236075..3237304 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BSUB_RS17240 (BSUB_03394) pncB 3237441..3238913 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=123731 BSUB_RS17215 WP_003242801.1 3233891..3234058(-) (comX) [Bacillus subtilis subsp. subtilis str. AG1839]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=123731 BSUB_RS17215 WP_003242801.1 3233891..3234058(-) (comX) [Bacillus subtilis subsp. subtilis str. AG1839]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment