Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   EG63_RS00215 Genome accession   NZ_CP007604
Coordinates   37465..37578 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain BM013A     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32465..42578
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EG63_RS00190 (EG63_00195) - 32518..34743 (+) 2226 WP_038417111.1 AAA family ATPase -
  EG63_RS00195 (EG63_00200) panD 34733..35086 (+) 354 WP_038417112.1 aspartate 1-decarboxylase -
  EG63_RS00200 (EG63_00205) - 35089..35391 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  EG63_RS00205 (EG63_00210) - 35391..36386 (+) 996 WP_038417113.1 PDZ domain-containing protein -
  EG63_RS00210 (EG63_00215) comB6 36394..37449 (+) 1056 WP_038417114.1 P-type conjugative transfer protein TrbL Machinery gene
  EG63_RS00215 comB7 37465..37578 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  EG63_RS00220 (EG63_00225) comB8 37575..38318 (+) 744 WP_038417115.1 type IV secretion system protein Machinery gene
  EG63_RS00225 (EG63_00230) comB9 38318..39289 (+) 972 WP_038417116.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EG63_RS00230 (EG63_00235) comB10 39282..40418 (+) 1137 WP_038417117.1 DNA type IV secretion system protein ComB10 Machinery gene
  EG63_RS00235 (EG63_00240) - 40488..41906 (+) 1419 WP_038417118.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=121562 EG63_RS00215 WP_001217873.1 37465..37578(+) (comB7) [Helicobacter pylori strain BM013A]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=121562 EG63_RS00215 WP_001217873.1 37465..37578(+) (comB7) [Helicobacter pylori strain BM013A]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAATAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment