Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   Q433_RS12480 Genome accession   NZ_CP007409
Coordinates   2410013..2410387 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2405013..2415387
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q433_RS12440 (Q433_13450) yqhG 2405345..2406139 (+) 795 WP_015714249.1 YqhG family protein -
  Q433_RS12445 (Q433_13455) sinI 2406322..2406495 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  Q433_RS12450 (Q433_13460) sinR 2406529..2406864 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  Q433_RS12455 (Q433_13465) tasA 2406957..2407742 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  Q433_RS12460 (Q433_13470) sipW 2407806..2408378 (-) 573 WP_072692741.1 signal peptidase I SipW -
  Q433_RS12465 (Q433_13475) tapA 2408362..2409123 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  Q433_RS12470 (Q433_13480) yqzG 2409394..2409720 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  Q433_RS12475 (Q433_13485) spoIITA 2409762..2409941 (-) 180 WP_029726723.1 YqzE family protein -
  Q433_RS12480 (Q433_13490) comGG 2410013..2410387 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  Q433_RS12485 (Q433_13495) comGF 2410388..2410771 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  Q433_RS12490 (Q433_13500) comGE 2410797..2411144 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  Q433_RS12495 (Q433_13505) comGD 2411128..2411559 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  Q433_RS12500 (Q433_13510) comGC 2411549..2411845 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  Q433_RS12505 (Q433_13515) comGB 2411859..2412896 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  Q433_RS12510 (Q433_13520) comGA 2412883..2413953 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  Q433_RS12520 (Q433_13530) - 2414166..2414363 (-) 198 WP_029726717.1 hypothetical protein -
  Q433_RS12525 (Q433_13535) corA 2414365..2415318 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=119219 Q433_RS12480 WP_029726722.1 2410013..2410387(-) (comGG) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=119219 Q433_RS12480 WP_029726722.1 2410013..2410387(-) (comGG) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952


Multiple sequence alignment