Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | Q433_RS12445 | Genome accession | NZ_CP007409 |
| Coordinates | 2406322..2406495 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2401322..2411495
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q433_RS12430 (Q433_13440) | gcvT | 2402122..2403210 (-) | 1089 | WP_015714248.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| Q433_RS12435 (Q433_13445) | hepAA | 2403651..2405324 (+) | 1674 | WP_029726726.1 | SNF2-related protein | - |
| Q433_RS12440 (Q433_13450) | yqhG | 2405345..2406139 (+) | 795 | WP_015714249.1 | YqhG family protein | - |
| Q433_RS12445 (Q433_13455) | sinI | 2406322..2406495 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| Q433_RS12450 (Q433_13460) | sinR | 2406529..2406864 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| Q433_RS12455 (Q433_13465) | tasA | 2406957..2407742 (-) | 786 | WP_014664586.1 | biofilm matrix protein TasA | - |
| Q433_RS12460 (Q433_13470) | sipW | 2407806..2408378 (-) | 573 | WP_072692741.1 | signal peptidase I SipW | - |
| Q433_RS12465 (Q433_13475) | tapA | 2408362..2409123 (-) | 762 | WP_029726724.1 | amyloid fiber anchoring/assembly protein TapA | - |
| Q433_RS12470 (Q433_13480) | yqzG | 2409394..2409720 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| Q433_RS12475 (Q433_13485) | spoIITA | 2409762..2409941 (-) | 180 | WP_029726723.1 | YqzE family protein | - |
| Q433_RS12480 (Q433_13490) | comGG | 2410013..2410387 (-) | 375 | WP_029726722.1 | ComG operon protein ComGG | Machinery gene |
| Q433_RS12485 (Q433_13495) | comGF | 2410388..2410771 (-) | 384 | WP_029726721.1 | ComG operon protein ComGF | Machinery gene |
| Q433_RS12490 (Q433_13500) | comGE | 2410797..2411144 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=119217 Q433_RS12445 WP_003230187.1 2406322..2406495(+) (sinI) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=119217 Q433_RS12445 WP_003230187.1 2406322..2406495(+) (sinI) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |