Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   Q433_RS12445 Genome accession   NZ_CP007409
Coordinates   2406322..2406495 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2401322..2411495
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q433_RS12430 (Q433_13440) gcvT 2402122..2403210 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  Q433_RS12435 (Q433_13445) hepAA 2403651..2405324 (+) 1674 WP_029726726.1 SNF2-related protein -
  Q433_RS12440 (Q433_13450) yqhG 2405345..2406139 (+) 795 WP_015714249.1 YqhG family protein -
  Q433_RS12445 (Q433_13455) sinI 2406322..2406495 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  Q433_RS12450 (Q433_13460) sinR 2406529..2406864 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  Q433_RS12455 (Q433_13465) tasA 2406957..2407742 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  Q433_RS12460 (Q433_13470) sipW 2407806..2408378 (-) 573 WP_072692741.1 signal peptidase I SipW -
  Q433_RS12465 (Q433_13475) tapA 2408362..2409123 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  Q433_RS12470 (Q433_13480) yqzG 2409394..2409720 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  Q433_RS12475 (Q433_13485) spoIITA 2409762..2409941 (-) 180 WP_029726723.1 YqzE family protein -
  Q433_RS12480 (Q433_13490) comGG 2410013..2410387 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  Q433_RS12485 (Q433_13495) comGF 2410388..2410771 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  Q433_RS12490 (Q433_13500) comGE 2410797..2411144 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=119217 Q433_RS12445 WP_003230187.1 2406322..2406495(+) (sinI) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=119217 Q433_RS12445 WP_003230187.1 2406322..2406495(+) (sinI) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment