Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   ACNUD9_RS07315 Genome accession   NZ_OZ197096
Coordinates   1529933..1530460 (-) Length   175 a.a.
NCBI ID   WP_416692159.1    Uniprot ID   -
Organism   Enterococcus faecalis isolate 23S00039-2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1503782..1541890 1529933..1530460 within 0


Gene organization within MGE regions


Location: 1503782..1541890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNUD9_RS07120 - 1503782..1504285 (-) 504 WP_284605679.1 Panacea domain-containing protein -
  ACNUD9_RS07125 - 1504579..1505682 (-) 1104 WP_416692112.1 SH3 domain-containing protein -
  ACNUD9_RS07130 - 1505724..1505933 (-) 210 WP_002370806.1 BhlA/UviB family holin-like peptide -
  ACNUD9_RS07135 - 1505940..1506062 (-) 123 WP_104874132.1 XkdX family protein -
  ACNUD9_RS07140 - 1506064..1506459 (-) 396 WP_338350231.1 hypothetical protein -
  ACNUD9_RS07145 - 1506473..1507174 (-) 702 WP_338350233.1 pyocin knob domain-containing protein -
  ACNUD9_RS07150 - 1507167..1508183 (-) 1017 WP_416692115.1 BppU family phage baseplate upper protein -
  ACNUD9_RS07155 - 1508199..1510913 (-) 2715 WP_416692117.1 phage tail spike protein -
  ACNUD9_RS07160 - 1510895..1511629 (-) 735 WP_416692119.1 phage tail protein -
  ACNUD9_RS07165 - 1511619..1514516 (-) 2898 WP_416693693.1 tape measure protein -
  ACNUD9_RS07170 gpG 1514765..1515118 (-) 354 WP_002364485.1 phage tail assembly chaperone G -
  ACNUD9_RS07175 - 1515171..1516013 (-) 843 WP_416692121.1 major tail protein -
  ACNUD9_RS07180 - 1516014..1516388 (-) 375 WP_113848044.1 phage tail terminator family protein -
  ACNUD9_RS07185 - 1516392..1516790 (-) 399 WP_002402415.1 HK97 gp10 family phage protein -
  ACNUD9_RS07190 - 1516783..1517160 (-) 378 WP_416692123.1 hypothetical protein -
  ACNUD9_RS07195 - 1517157..1517501 (-) 345 WP_002395886.1 hypothetical protein -
  ACNUD9_RS07200 - 1517510..1517746 (-) 237 WP_416692126.1 hypothetical protein -
  ACNUD9_RS07205 - 1517770..1518672 (-) 903 WP_373966784.1 SU10 major capsid protein -
  ACNUD9_RS07210 - 1518686..1519315 (-) 630 WP_202236695.1 capsid assembly scaffolding protein Gp46 family protein -
  ACNUD9_RS07215 - 1519484..1519720 (-) 237 WP_225583308.1 hypothetical protein -
  ACNUD9_RS07220 - 1519786..1520106 (-) 321 WP_416692129.1 hypothetical protein -
  ACNUD9_RS07225 - 1520109..1521155 (-) 1047 WP_416692131.1 phage head morphogenesis protein -
  ACNUD9_RS07230 - 1521130..1522605 (-) 1476 WP_416692133.1 phage portal protein -
  ACNUD9_RS07235 terL 1522618..1524006 (-) 1389 WP_416692135.1 phage terminase large subunit -
  ACNUD9_RS07240 - 1523999..1524460 (-) 462 WP_416692137.1 helix-turn-helix domain-containing protein -
  ACNUD9_RS07245 - 1524527..1525171 (-) 645 WP_416692139.1 hypothetical protein -
  ACNUD9_RS07250 - 1525422..1525841 (-) 420 WP_002404562.1 transcriptional regulator -
  ACNUD9_RS07255 - 1525842..1526054 (-) 213 WP_416693695.1 hypothetical protein -
  ACNUD9_RS07260 - 1526246..1526851 (-) 606 WP_416692141.1 DUF3850 domain-containing protein -
  ACNUD9_RS07265 - 1526848..1527054 (-) 207 WP_010730055.1 hypothetical protein -
  ACNUD9_RS07270 - 1527066..1527314 (-) 249 WP_233050380.1 hypothetical protein -
  ACNUD9_RS07275 - 1527311..1527553 (-) 243 WP_416692143.1 hypothetical protein -
  ACNUD9_RS07280 - 1527572..1527829 (-) 258 WP_416692145.1 hypothetical protein -
  ACNUD9_RS07285 - 1527822..1528169 (-) 348 WP_416692147.1 hypothetical protein -
  ACNUD9_RS07290 - 1528166..1528600 (-) 435 WP_416692149.1 YopX family protein -
  ACNUD9_RS07295 - 1528621..1528941 (-) 321 WP_416692151.1 PcfU -
  ACNUD9_RS07300 - 1528959..1529165 (-) 207 WP_416692153.1 hypothetical protein -
  ACNUD9_RS07305 - 1529175..1529573 (-) 399 WP_416692155.1 hypothetical protein -
  ACNUD9_RS07310 - 1529592..1529921 (-) 330 WP_416692157.1 hypothetical protein -
  ACNUD9_RS07315 ssb 1529933..1530460 (-) 528 WP_416692159.1 single-stranded DNA-binding protein Machinery gene
  ACNUD9_RS07320 - 1530519..1530821 (-) 303 WP_416692161.1 hypothetical protein -
  ACNUD9_RS07325 - 1530824..1531666 (-) 843 WP_416693696.1 DNA replication protein -
  ACNUD9_RS07330 - 1531686..1532327 (-) 642 WP_416692163.1 putative HNHc nuclease -
  ACNUD9_RS07335 - 1532332..1533018 (-) 687 WP_416692165.1 DUF1071 domain-containing protein -
  ACNUD9_RS07340 - 1533011..1533334 (-) 324 WP_416692167.1 hypothetical protein -
  ACNUD9_RS07345 - 1533419..1533721 (-) 303 WP_002404544.1 hypothetical protein -
  ACNUD9_RS07350 - 1533887..1534072 (+) 186 WP_025188165.1 YegP family protein -
  ACNUD9_RS07355 - 1534389..1534580 (-) 192 WP_236547317.1 hypothetical protein -
  ACNUD9_RS07360 - 1534591..1534776 (-) 186 WP_033598023.1 hypothetical protein -
  ACNUD9_RS07365 - 1534787..1535500 (-) 714 WP_416692170.1 Rha family transcriptional regulator -
  ACNUD9_RS07370 - 1535580..1535747 (+) 168 WP_416692172.1 hypothetical protein -
  ACNUD9_RS07375 - 1535939..1536277 (-) 339 WP_416692174.1 DUF771 domain-containing protein -
  ACNUD9_RS07380 - 1536289..1536480 (-) 192 WP_002371609.1 hypothetical protein -
  ACNUD9_RS07385 - 1536770..1537111 (+) 342 WP_243572903.1 helix-turn-helix domain-containing protein -
  ACNUD9_RS07390 - 1537112..1537534 (+) 423 WP_080279980.1 ImmA/IrrE family metallo-endopeptidase -
  ACNUD9_RS07395 - 1537622..1538356 (+) 735 WP_416692177.1 DUF4950 domain-containing protein -
  ACNUD9_RS07400 - 1538370..1538984 (+) 615 WP_064687094.1 SHOCT domain-containing protein -
  ACNUD9_RS07405 - 1539096..1540232 (+) 1137 WP_010712197.1 site-specific integrase -
  ACNUD9_RS07415 - 1540697..1541890 (-) 1194 WP_002355922.1 GNAT family N-acetyltransferase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19277.11 Da        Isoelectric Point: 4.7078

>NTDB_id=1169479 ACNUD9_RS07315 WP_416692159.1 1529933..1530460(-) (ssb) [Enterococcus faecalis isolate 23S00039-2]
MINNVVLVGRLTKDPDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEPKSANENRNSVQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQISFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=1169479 ACNUD9_RS07315 WP_416692159.1 1529933..1530460(-) (ssb) [Enterococcus faecalis isolate 23S00039-2]
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCCTGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAATTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGCCAAAAAG
CGCCAATGAGAATAGAAATAGCGTTCAGAGTTCACAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATATCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.989

100

0.6
  ssbA Bacillus subtilis subsp. subtilis str. 168

57.865

100

0.589
  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

60.571

0.366

Multiple sequence alignment