Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AW02_RS12300 | Genome accession | NZ_CP007165 |
| Coordinates | 2607014..2607187 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis NJN-6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2602014..2612187
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AW02_RS12285 (AW02_024450) | gcvT | 2602832..2603932 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AW02_RS12290 (AW02_024460) | - | 2604355..2606025 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| AW02_RS12295 (AW02_024470) | - | 2606043..2606837 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| AW02_RS12300 (AW02_024480) | sinI | 2607014..2607187 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AW02_RS12305 (AW02_024490) | sinR | 2607221..2607556 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AW02_RS12310 (AW02_024500) | tasA | 2607604..2608389 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| AW02_RS12315 (AW02_024510) | sipW | 2608453..2609037 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| AW02_RS12320 (AW02_024520) | tapA | 2609009..2609680 (-) | 672 | WP_046341384.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AW02_RS12325 (AW02_024530) | - | 2609939..2610268 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| AW02_RS12330 (AW02_024540) | - | 2610308..2610487 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AW02_RS12335 (AW02_024550) | comGG | 2610544..2610921 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AW02_RS12340 (AW02_024560) | comGF | 2610922..2611317 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| AW02_RS12345 (AW02_024570) | comGE | 2611331..2611645 (-) | 315 | WP_046341385.1 | competence type IV pilus minor pilin ComGE | - |
| AW02_RS12350 (AW02_024580) | comGD | 2611629..2612066 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=116713 AW02_RS12300 WP_003153105.1 2607014..2607187(+) (sinI) [Bacillus velezensis NJN-6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=116713 AW02_RS12300 WP_003153105.1 2607014..2607187(+) (sinI) [Bacillus velezensis NJN-6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |