Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB3Y92_RS15135 Genome accession   NZ_OZ061327
Coordinates   2899572..2899712 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus isolate Bacillus pumilus CIRM-BIA2784     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2894572..2904712
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3Y92_RS15110 - 2894834..2895223 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  AB3Y92_RS15115 comA 2895247..2895888 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  AB3Y92_RS15120 comP 2895969..2898284 (-) 2316 WP_144461870.1 ATP-binding protein Regulator
  AB3Y92_RS15125 comX 2898342..2898509 (-) 168 WP_081042274.1 competence pheromone ComX -
  AB3Y92_RS15130 - 2898506..2899420 (-) 915 WP_061409480.1 polyprenyl synthetase family protein -
  AB3Y92_RS15135 degQ 2899572..2899712 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AB3Y92_RS15140 - 2900218..2900571 (+) 354 WP_058013790.1 hypothetical protein -
  AB3Y92_RS15145 - 2900603..2901829 (-) 1227 WP_012011110.1 EAL and HDOD domain-containing protein -
  AB3Y92_RS15150 - 2901969..2903438 (-) 1470 WP_058013789.1 nicotinate phosphoribosyltransferase -
  AB3Y92_RS15155 - 2903456..2904007 (-) 552 WP_058013788.1 cysteine hydrolase family protein -
  AB3Y92_RS15160 - 2904068..2904475 (-) 408 WP_058013787.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1165928 AB3Y92_RS15135 WP_003213123.1 2899572..2899712(-) (degQ) [Bacillus pumilus isolate Bacillus pumilus CIRM-BIA2784]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1165928 AB3Y92_RS15135 WP_003213123.1 2899572..2899712(-) (degQ) [Bacillus pumilus isolate Bacillus pumilus CIRM-BIA2784]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment