Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   AF91_RS10805 Genome accession   NZ_CP007122
Coordinates   2199605..2200090 (-) Length   161 a.a.
NCBI ID   WP_025376267.1    Uniprot ID   A0A806LFU3
Organism   Lacticaseibacillus paracasei N1115     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2167739..2210776 2199605..2200090 within 0


Gene organization within MGE regions


Location: 2167739..2210776
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AF91_RS10605 (AF91_10955) - 2167739..2167963 (-) 225 WP_025376236.1 hypothetical protein -
  AF91_RS10610 (AF91_10960) - 2168008..2169306 (-) 1299 WP_025376237.1 LysM peptidoglycan-binding domain-containing protein -
  AF91_RS10615 (AF91_10965) - 2169317..2169763 (-) 447 WP_016366166.1 phage holin -
  AF91_RS10620 (AF91_10970) - 2169760..2169966 (-) 207 WP_025376238.1 hypothetical protein -
  AF91_RS10625 (AF91_10975) - 2169947..2170333 (-) 387 WP_025376075.1 hypothetical protein -
  AF91_RS17575 - 2170364..2170426 (-) 63 WP_235716403.1 hypothetical protein -
  AF91_RS10630 (AF91_10980) - 2170488..2170778 (-) 291 WP_025376074.1 hypothetical protein -
  AF91_RS10635 (AF91_10985) - 2170788..2174003 (-) 3216 WP_025376239.1 phage tail protein -
  AF91_RS10640 (AF91_10990) - 2174004..2175989 (-) 1986 WP_025376240.1 distal tail protein Dit -
  AF91_RS10645 (AF91_10995) - 2175986..2180617 (-) 4632 WP_025376241.1 tape measure protein -
  AF91_RS10650 (AF91_11000) - 2180636..2181256 (-) 621 WP_019887723.1 Gp15 family bacteriophage protein -
  AF91_RS10655 (AF91_11005) - 2181249..2181680 (-) 432 WP_025376242.1 hypothetical protein -
  AF91_RS10660 (AF91_11010) - 2181746..2181955 (-) 210 WP_025376243.1 Ig domain-containing protein -
  AF91_RS10665 (AF91_11015) - 2182000..2182467 (-) 468 WP_025376244.1 phage tail tube protein -
  AF91_RS10670 (AF91_11020) - 2182474..2182866 (-) 393 WP_025376245.1 minor capsid protein -
  AF91_RS10675 (AF91_11025) - 2182863..2183231 (-) 369 WP_025376246.1 minor capsid protein -
  AF91_RS10680 (AF91_11030) - 2183231..2183581 (-) 351 WP_025376247.1 putative minor capsid protein -
  AF91_RS10685 (AF91_11035) - 2183571..2183990 (-) 420 WP_025376248.1 hypothetical protein -
  AF91_RS17835 (AF91_11040) - 2184054..2185046 (-) 993 WP_025376249.1 N4-gp56 family major capsid protein -
  AF91_RS10695 (AF91_11045) - 2185062..2185655 (-) 594 WP_025376250.1 phage scaffolding protein -
  AF91_RS10700 (AF91_11050) - 2185746..2186891 (-) 1146 WP_044003380.1 phage minor capsid protein -
  AF91_RS10705 (AF91_11055) - 2186891..2188489 (-) 1599 WP_025376252.1 phage portal protein -
  AF91_RS10710 (AF91_11060) - 2188502..2189818 (-) 1317 WP_025376253.1 PBSX family phage terminase large subunit -
  AF91_RS10715 (AF91_11065) - 2189796..2190329 (-) 534 WP_025376254.1 terminase small subunit -
  AF91_RS17580 (AF91_11070) - 2190398..2190532 (-) 135 WP_080687515.1 hypothetical protein -
  AF91_RS10720 (AF91_11075) - 2190715..2191863 (-) 1149 WP_025376058.1 GcrA family cell cycle regulator -
  AF91_RS10725 (AF91_11080) - 2192163..2192681 (-) 519 WP_016372094.1 hypothetical protein -
  AF91_RS10730 (AF91_11085) - 2192707..2193732 (-) 1026 WP_016372093.1 DUF6731 family protein -
  AF91_RS17305 - 2193995..2194144 (+) 150 WP_171815641.1 hypothetical protein -
  AF91_RS10740 (AF91_11090) - 2194201..2194629 (-) 429 WP_003582019.1 hypothetical protein -
  AF91_RS10745 (AF91_11100) - 2195041..2195259 (-) 219 WP_025376255.1 helix-turn-helix domain-containing protein -
  AF91_RS10750 (AF91_11105) - 2195337..2195621 (-) 285 WP_044003593.1 hypothetical protein -
  AF91_RS10755 (AF91_11110) - 2195698..2196075 (-) 378 WP_080687516.1 YopX family protein -
  AF91_RS10760 (AF91_11115) - 2196072..2196560 (-) 489 WP_025376258.1 class I SAM-dependent methyltransferase -
  AF91_RS10765 (AF91_11120) - 2196572..2196832 (-) 261 WP_025376259.1 hypothetical protein -
  AF91_RS10770 (AF91_11125) - 2196829..2197239 (-) 411 WP_025376260.1 hypothetical protein -
  AF91_RS10775 (AF91_11130) - 2197229..2197432 (-) 204 WP_025376261.1 hypothetical protein -
  AF91_RS10780 (AF91_11135) - 2197419..2197868 (-) 450 WP_258446734.1 DUF1642 domain-containing protein -
  AF91_RS10785 (AF91_11140) - 2197993..2198232 (-) 240 WP_025376263.1 hypothetical protein -
  AF91_RS10790 (AF91_11145) - 2198271..2198735 (-) 465 WP_025376264.1 hypothetical protein -
  AF91_RS10795 (AF91_11150) - 2198754..2199137 (-) 384 WP_025376265.1 DUF1064 domain-containing protein -
  AF91_RS10800 (AF91_11155) - 2199140..2199589 (-) 450 WP_025376266.1 hypothetical protein -
  AF91_RS10805 (AF91_11160) ssb 2199605..2200090 (-) 486 WP_025376267.1 single-stranded DNA-binding protein Machinery gene
  AF91_RS10810 (AF91_11165) - 2200103..2201056 (-) 954 WP_025376268.1 DnaD domain protein -
  AF91_RS10815 (AF91_11170) - 2201072..2201974 (-) 903 WP_309300347.1 PD-(D/E)XK nuclease-like domain-containing protein -
  AF91_RS10820 (AF91_11175) - 2201856..2202722 (-) 867 WP_025376270.1 recombinase RecT -
  AF91_RS17310 (AF91_11180) - 2202736..2202906 (-) 171 WP_019885640.1 hypothetical protein -
  AF91_RS10825 (AF91_11185) - 2202908..2203150 (-) 243 WP_080687517.1 hypothetical protein -
  AF91_RS17585 (AF91_11190) - 2203138..2203266 (-) 129 WP_080687518.1 hypothetical protein -
  AF91_RS10830 (AF91_11195) - 2203269..2203595 (-) 327 WP_003581994.1 hypothetical protein -
  AF91_RS10835 (AF91_11200) - 2203586..2204059 (-) 474 WP_025376272.1 helix-turn-helix domain-containing protein -
  AF91_RS16180 (AF91_11205) - 2204122..2204280 (-) 159 WP_011674683.1 hypothetical protein -
  AF91_RS10840 (AF91_11210) - 2204368..2204595 (+) 228 WP_016371378.1 DUF2188 domain-containing protein -
  AF91_RS17315 (AF91_11215) - 2204592..2204747 (-) 156 WP_003582323.1 hypothetical protein -
  AF91_RS10845 (AF91_11220) - 2204744..2204971 (-) 228 WP_025376273.1 helix-turn-helix transcriptional regulator -
  AF91_RS10850 (AF91_11225) - 2205118..2205546 (+) 429 WP_025376274.1 helix-turn-helix domain-containing protein -
  AF91_RS17080 (AF91_11230) - 2205556..2206017 (+) 462 WP_144235244.1 ImmA/IrrE family metallo-endopeptidase -
  AF91_RS10865 (AF91_11235) - 2206077..2206586 (+) 510 WP_025376275.1 hypothetical protein -
  AF91_RS10870 (AF91_11240) - 2206669..2207418 (+) 750 WP_025376036.1 hypothetical protein -
  AF91_RS10875 (AF91_11245) - 2207390..2207584 (-) 195 WP_144235239.1 hypothetical protein -
  AF91_RS10880 (AF91_11250) - 2207719..2208144 (+) 426 WP_025376276.1 pyridoxamine 5'-phosphate oxidase family protein -
  AF91_RS10885 (AF91_11255) - 2208168..2208368 (+) 201 WP_025376277.1 hypothetical protein -
  AF91_RS10890 (AF91_11260) - 2208455..2208847 (+) 393 WP_025376278.1 hypothetical protein -
  AF91_RS10895 (AF91_11265) - 2208859..2209452 (+) 594 WP_025376279.1 hypothetical protein -
  AF91_RS10900 (AF91_11270) - 2209562..2210776 (+) 1215 WP_044003389.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 161 a.a.        Molecular weight: 17589.28 Da        Isoelectric Point: 6.3513

>NTDB_id=116366 AF91_RS10805 WP_025376267.1 2199605..2200090(-) (ssb) [Lacticaseibacillus paracasei N1115]
MLNSISLTGRLTRDVDLRYTQSGTAVGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQTSQNSPKSQQTANGSAAATTNASQTTPNASQSNATDPFANNGQPIDIQDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=116366 AF91_RS10805 WP_025376267.1 2199605..2200090(-) (ssb) [Lacticaseibacillus paracasei N1115]
TTGCTAAACAGTATCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGCTACACACAAAGTGGAACCGCTGTCGG
CTCGTTCACGCTTGCTGTTGATCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACCAAAAAAGGCTCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GACGTCTCAGAACAGCCCTAAATCACAGCAAACAGCCAATGGATCAGCAGCAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCGCAATCGAATGCCACAGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A806LFU3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

63.372

100

0.677
  ssbA Bacillus subtilis subsp. subtilis str. 168

48.837

100

0.522
  ssbB Bacillus subtilis subsp. subtilis str. 168

55.66

65.839

0.366

Multiple sequence alignment