Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilI   Type   Machinery gene
Locus tag   AABJ29_RS02330 Genome accession   NZ_OZ004876
Coordinates   452777..453385 (+) Length   202 a.a.
NCBI ID   WP_338362088.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae isolate 632_2023     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 450369..500385 452777..453385 within 0


Gene organization within MGE regions


Location: 450369..500385
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ29_RS02320 dnaB 450369..451775 (+) 1407 WP_241532347.1 replicative DNA helicase -
  AABJ29_RS02325 pilH 452083..452748 (+) 666 WP_263055817.1 GspH/FimT family pseudopilin Machinery gene
  AABJ29_RS02330 pilI 452777..453385 (+) 609 WP_338362088.1 type IV pilus modification protein PilV Machinery gene
  AABJ29_RS02335 pilJ 453382..454350 (+) 969 WP_260236889.1 PilW family protein Machinery gene
  AABJ29_RS02340 pilK 454329..454937 (+) 609 WP_215318018.1 pilus assembly PilX family protein Machinery gene
  AABJ29_RS02345 pilL 454939..455412 (+) 474 WP_260237126.1 PilX family type IV pilin Machinery gene
  AABJ29_RS02350 - 456024..456469 (-) 446 Protein_458 AzlC family ABC transporter permease -
  AABJ29_RS02355 dut 456635..457087 (+) 453 WP_260236890.1 dUTP diphosphatase -
  AABJ29_RS02360 dapC 457165..458352 (+) 1188 WP_260236891.1 succinyldiaminopimelate transaminase -
  AABJ29_RS02365 yaaA 458663..459442 (+) 780 WP_260236892.1 peroxide stress protein YaaA -
  AABJ29_RS02380 - 459973..461165 (+) 1193 Protein_462 integrase arm-type DNA-binding domain-containing protein -
  AABJ29_RS02385 - 461520..461789 (-) 270 WP_003687928.1 hypothetical protein -
  AABJ29_RS02390 - 461984..462667 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  AABJ29_RS02395 - 462981..463214 (-) 234 Protein_465 hypothetical protein -
  AABJ29_RS02400 - 463325..463540 (-) 216 WP_003693860.1 hypothetical protein -
  AABJ29_RS02405 - 463592..464083 (-) 492 WP_263074863.1 siphovirus Gp157 family protein -
  AABJ29_RS02410 - 464080..464262 (-) 183 WP_260236894.1 hypothetical protein -
  AABJ29_RS02415 - 464402..465088 (-) 687 WP_263055815.1 phage replication initiation protein, NGO0469 family -
  AABJ29_RS02420 - 465157..465318 (-) 162 WP_047924242.1 hypothetical protein -
  AABJ29_RS02425 - 465315..465590 (-) 276 WP_003695501.1 NGO1622 family putative holin -
  AABJ29_RS02430 - 465743..466075 (-) 333 WP_105183567.1 hypothetical protein -
  AABJ29_RS02435 - 466214..466408 (-) 195 WP_003703103.1 hypothetical protein -
  AABJ29_RS02440 - 466892..467110 (+) 219 WP_003691731.1 hypothetical protein -
  AABJ29_RS02445 - 467127..467486 (-) 360 WP_003691733.1 hypothetical protein -
  AABJ29_RS02450 - 467487..468026 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  AABJ29_RS02455 - 468186..468902 (-) 717 WP_003695999.1 XRE family transcriptional regulator -
  AABJ29_RS02460 - 469283..469510 (+) 228 WP_050158909.1 helix-turn-helix domain-containing protein -
  AABJ29_RS02465 - 469507..469644 (+) 138 WP_010359998.1 hypothetical protein -
  AABJ29_RS02470 - 469628..470626 (+) 999 WP_050161100.1 hypothetical protein -
  AABJ29_RS02475 - 470623..471984 (+) 1362 WP_260236895.1 DnaB-like helicase C-terminal domain-containing protein -
  AABJ29_RS02480 - 472001..472252 (+) 252 WP_338362097.1 hypothetical protein -
  AABJ29_RS02485 - 472266..472760 (+) 495 WP_115067539.1 DUF3310 domain-containing protein -
  AABJ29_RS02490 - 472958..473107 (+) 150 WP_003692854.1 hypothetical protein -
  AABJ29_RS02495 - 473136..473417 (+) 282 WP_229691900.1 hypothetical protein -
  AABJ29_RS02500 - 473408..473842 (+) 435 WP_260245439.1 RusA family crossover junction endodeoxyribonuclease -
  AABJ29_RS02505 - 473835..474140 (+) 306 WP_053015205.1 DUF1364 domain-containing protein -
  AABJ29_RS02510 - 474137..474520 (+) 384 WP_003687982.1 recombination protein NinB -
  AABJ29_RS02515 - 474511..475029 (+) 519 WP_003687984.1 HNH endonuclease -
  AABJ29_RS02520 - 475094..475516 (+) 423 WP_003690919.1 hypothetical protein -
  AABJ29_RS02525 - 475516..476055 (+) 540 WP_003693457.1 hypothetical protein -
  AABJ29_RS02530 - 476036..477310 (+) 1275 WP_311201960.1 PBSX family phage terminase large subunit -
  AABJ29_RS02535 - 477295..479562 (+) 2268 WP_225577699.1 hypothetical protein -
  AABJ29_RS02540 - 479802..480326 (+) 525 WP_260236900.1 hypothetical protein -
  AABJ29_RS02545 - 480323..480997 (+) 675 WP_260236901.1 hypothetical protein -
  AABJ29_RS02550 - 480994..488760 (+) 7767 WP_338362102.1 PLxRFG domain-containing protein -
  AABJ29_RS02555 - 488858..489265 (+) 408 WP_082298808.1 hypothetical protein -
  AABJ29_RS02560 - 489276..489701 (+) 426 WP_106336882.1 hypothetical protein -
  AABJ29_RS02565 - 489694..490581 (+) 888 WP_082298758.1 hypothetical protein -
  AABJ29_RS02570 - 490581..490961 (+) 381 WP_082298757.1 hypothetical protein -
  AABJ29_RS02575 - 490964..494170 (+) 3207 WP_260245440.1 hypothetical protein -
  AABJ29_RS02580 - 494158..495351 (+) 1194 WP_134921505.1 hypothetical protein -
  AABJ29_RS02585 - 495436..496335 (+) 900 WP_260236904.1 hypothetical protein -
  AABJ29_RS02590 - 496356..497651 (+) 1296 Protein_504 DUF4043 family protein -
  AABJ29_RS02595 - 497710..498183 (+) 474 WP_003693439.1 hypothetical protein -
  AABJ29_RS02600 - 498189..498674 (+) 486 WP_003693438.1 hypothetical protein -
  AABJ29_RS02605 - 498671..499345 (+) 675 WP_003693436.1 hypothetical protein -
  AABJ29_RS02610 - 499348..499497 (+) 150 WP_017146863.1 hypothetical protein -
  AABJ29_RS02615 - 499534..500385 (-) 852 WP_106336892.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 202 a.a.        Molecular weight: 21942.90 Da        Isoelectric Point: 4.8017

>NTDB_id=1162614 AABJ29_RS02330 WP_338362088.1 452777..453385(+) (pilI) [Neisseria gonorrhoeae isolate 632_2023]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYTGSYPPTSSDGDFKLNTLISKRDLAKAQLDRFGYELKNALPDVVAIRYAVCKDSSGNAPTLSGGTFSPNCDDKANG
DTLIKVLWVNDSAGDSDIARTNLEVSGDNIVYTYQARVGGRE

Nucleotide


Download         Length: 609 bp        

>NTDB_id=1162614 AABJ29_RS02330 WP_338362088.1 452777..453385(+) (pilI) [Neisseria gonorrhoeae isolate 632_2023]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGGGGTCGTACCCCCCCACTTCCTCTGACGGCGATTTCAAGCTTAATACTTTGATAAGTAAGAGGGA
TTTGGCAAAAGCCCAGTTGGACAGGTTCGGTTATGAATTGAAAAACGCCTTGCCGGATGTGGTAGCTATTCGTTACGCCG
TCTGCAAGGATTCGTCGGGTAACGCGCCGACATTGTCCGGCGGTACTTTTTCTCCAAATTGCGATGATAAGGCAAACGGG
GATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATCGCCCGTACGAATCTTGAAGTGAGCGG
CGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilI Neisseria gonorrhoeae MS11

94.059

100

0.941
  pilV Neisseria gonorrhoeae MS11

94.059

100

0.941
  pilV Neisseria meningitidis 8013

84.951

100

0.866

Multiple sequence alignment