Detailed information
Overview
| Name | pilK | Type | Machinery gene |
| Locus tag | AABJ29_RS02340 | Genome accession | NZ_OZ004876 |
| Coordinates | 454329..454937 (+) | Length | 202 a.a. |
| NCBI ID | WP_215318018.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae isolate 632_2023 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 450369..500385 | 454329..454937 | within | 0 |
Gene organization within MGE regions
Location: 450369..500385
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABJ29_RS02320 | dnaB | 450369..451775 (+) | 1407 | WP_241532347.1 | replicative DNA helicase | - |
| AABJ29_RS02325 | pilH | 452083..452748 (+) | 666 | WP_263055817.1 | GspH/FimT family pseudopilin | Machinery gene |
| AABJ29_RS02330 | pilI | 452777..453385 (+) | 609 | WP_338362088.1 | type IV pilus modification protein PilV | Machinery gene |
| AABJ29_RS02335 | pilJ | 453382..454350 (+) | 969 | WP_260236889.1 | PilW family protein | Machinery gene |
| AABJ29_RS02340 | pilK | 454329..454937 (+) | 609 | WP_215318018.1 | pilus assembly PilX family protein | Machinery gene |
| AABJ29_RS02345 | pilL | 454939..455412 (+) | 474 | WP_260237126.1 | PilX family type IV pilin | Machinery gene |
| AABJ29_RS02350 | - | 456024..456469 (-) | 446 | Protein_458 | AzlC family ABC transporter permease | - |
| AABJ29_RS02355 | dut | 456635..457087 (+) | 453 | WP_260236890.1 | dUTP diphosphatase | - |
| AABJ29_RS02360 | dapC | 457165..458352 (+) | 1188 | WP_260236891.1 | succinyldiaminopimelate transaminase | - |
| AABJ29_RS02365 | yaaA | 458663..459442 (+) | 780 | WP_260236892.1 | peroxide stress protein YaaA | - |
| AABJ29_RS02380 | - | 459973..461165 (+) | 1193 | Protein_462 | integrase arm-type DNA-binding domain-containing protein | - |
| AABJ29_RS02385 | - | 461520..461789 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| AABJ29_RS02390 | - | 461984..462667 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| AABJ29_RS02395 | - | 462981..463214 (-) | 234 | Protein_465 | hypothetical protein | - |
| AABJ29_RS02400 | - | 463325..463540 (-) | 216 | WP_003693860.1 | hypothetical protein | - |
| AABJ29_RS02405 | - | 463592..464083 (-) | 492 | WP_263074863.1 | siphovirus Gp157 family protein | - |
| AABJ29_RS02410 | - | 464080..464262 (-) | 183 | WP_260236894.1 | hypothetical protein | - |
| AABJ29_RS02415 | - | 464402..465088 (-) | 687 | WP_263055815.1 | phage replication initiation protein, NGO0469 family | - |
| AABJ29_RS02420 | - | 465157..465318 (-) | 162 | WP_047924242.1 | hypothetical protein | - |
| AABJ29_RS02425 | - | 465315..465590 (-) | 276 | WP_003695501.1 | NGO1622 family putative holin | - |
| AABJ29_RS02430 | - | 465743..466075 (-) | 333 | WP_105183567.1 | hypothetical protein | - |
| AABJ29_RS02435 | - | 466214..466408 (-) | 195 | WP_003703103.1 | hypothetical protein | - |
| AABJ29_RS02440 | - | 466892..467110 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| AABJ29_RS02445 | - | 467127..467486 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| AABJ29_RS02450 | - | 467487..468026 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| AABJ29_RS02455 | - | 468186..468902 (-) | 717 | WP_003695999.1 | XRE family transcriptional regulator | - |
| AABJ29_RS02460 | - | 469283..469510 (+) | 228 | WP_050158909.1 | helix-turn-helix domain-containing protein | - |
| AABJ29_RS02465 | - | 469507..469644 (+) | 138 | WP_010359998.1 | hypothetical protein | - |
| AABJ29_RS02470 | - | 469628..470626 (+) | 999 | WP_050161100.1 | hypothetical protein | - |
| AABJ29_RS02475 | - | 470623..471984 (+) | 1362 | WP_260236895.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| AABJ29_RS02480 | - | 472001..472252 (+) | 252 | WP_338362097.1 | hypothetical protein | - |
| AABJ29_RS02485 | - | 472266..472760 (+) | 495 | WP_115067539.1 | DUF3310 domain-containing protein | - |
| AABJ29_RS02490 | - | 472958..473107 (+) | 150 | WP_003692854.1 | hypothetical protein | - |
| AABJ29_RS02495 | - | 473136..473417 (+) | 282 | WP_229691900.1 | hypothetical protein | - |
| AABJ29_RS02500 | - | 473408..473842 (+) | 435 | WP_260245439.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AABJ29_RS02505 | - | 473835..474140 (+) | 306 | WP_053015205.1 | DUF1364 domain-containing protein | - |
| AABJ29_RS02510 | - | 474137..474520 (+) | 384 | WP_003687982.1 | recombination protein NinB | - |
| AABJ29_RS02515 | - | 474511..475029 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| AABJ29_RS02520 | - | 475094..475516 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| AABJ29_RS02525 | - | 475516..476055 (+) | 540 | WP_003693457.1 | hypothetical protein | - |
| AABJ29_RS02530 | - | 476036..477310 (+) | 1275 | WP_311201960.1 | PBSX family phage terminase large subunit | - |
| AABJ29_RS02535 | - | 477295..479562 (+) | 2268 | WP_225577699.1 | hypothetical protein | - |
| AABJ29_RS02540 | - | 479802..480326 (+) | 525 | WP_260236900.1 | hypothetical protein | - |
| AABJ29_RS02545 | - | 480323..480997 (+) | 675 | WP_260236901.1 | hypothetical protein | - |
| AABJ29_RS02550 | - | 480994..488760 (+) | 7767 | WP_338362102.1 | PLxRFG domain-containing protein | - |
| AABJ29_RS02555 | - | 488858..489265 (+) | 408 | WP_082298808.1 | hypothetical protein | - |
| AABJ29_RS02560 | - | 489276..489701 (+) | 426 | WP_106336882.1 | hypothetical protein | - |
| AABJ29_RS02565 | - | 489694..490581 (+) | 888 | WP_082298758.1 | hypothetical protein | - |
| AABJ29_RS02570 | - | 490581..490961 (+) | 381 | WP_082298757.1 | hypothetical protein | - |
| AABJ29_RS02575 | - | 490964..494170 (+) | 3207 | WP_260245440.1 | hypothetical protein | - |
| AABJ29_RS02580 | - | 494158..495351 (+) | 1194 | WP_134921505.1 | hypothetical protein | - |
| AABJ29_RS02585 | - | 495436..496335 (+) | 900 | WP_260236904.1 | hypothetical protein | - |
| AABJ29_RS02590 | - | 496356..497651 (+) | 1296 | Protein_504 | DUF4043 family protein | - |
| AABJ29_RS02595 | - | 497710..498183 (+) | 474 | WP_003693439.1 | hypothetical protein | - |
| AABJ29_RS02600 | - | 498189..498674 (+) | 486 | WP_003693438.1 | hypothetical protein | - |
| AABJ29_RS02605 | - | 498671..499345 (+) | 675 | WP_003693436.1 | hypothetical protein | - |
| AABJ29_RS02610 | - | 499348..499497 (+) | 150 | WP_017146863.1 | hypothetical protein | - |
| AABJ29_RS02615 | - | 499534..500385 (-) | 852 | WP_106336892.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 202 a.a. Molecular weight: 21884.77 Da Isoelectric Point: 8.4516
>NTDB_id=1162616 AABJ29_RS02340 WP_215318018.1 454329..454937(+) (pilK) [Neisseria gonorrhoeae isolate 632_2023]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCGKGLCTAVNVRTNNANEESFGNIVVQSTPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTASVSKMPR
YIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCGKGLCTAVNVRTNNANEESFGNIVVQSTPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTASVSKMPR
YIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
Nucleotide
Download Length: 609 bp
>NTDB_id=1162616 AABJ29_RS02340 WP_215318018.1 454329..454937(+) (pilK) [Neisseria gonorrhoeae isolate 632_2023]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGGAAAAGGCCTGTGTACCGCAGTGAATGTACGGACAAATAATGCTAATGA
AGAGTCTTTTGGCAATATCGTGGTGCAAAGCACGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTGGCA
AAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGCACGGCAAGCGTCAGCAAAATGCCGCGC
TATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAA
TACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGGAAAAGGCCTGTGTACCGCAGTGAATGTACGGACAAATAATGCTAATGA
AGAGTCTTTTGGCAATATCGTGGTGCAAAGCACGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTGGCA
AAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGCACGGCAAGCGTCAGCAAAATGCCGCGC
TATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAA
TACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilK | Neisseria gonorrhoeae MS11 |
94.581 |
100 |
0.95 |