Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP47_RS17100 Genome accession   NZ_OX419577
Coordinates   3173209..3173349 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6120     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3168209..3178349
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP47_RS17075 (NRS6120_17620) yuxO 3168518..3168898 (-) 381 WP_071579112.1 hotdog fold thioesterase -
  KJP47_RS17080 (NRS6120_17625) comA 3168917..3169561 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP47_RS17085 (NRS6120_17630) comP 3169642..3171951 (-) 2310 WP_213382590.1 histidine kinase Regulator
  KJP47_RS17090 (NRS6120_17635) comX 3171970..3172137 (-) 168 WP_041057586.1 competence pheromone ComX Regulator
  KJP47_RS17095 (NRS6120_17640) comQ 3172125..3173024 (-) 900 WP_038828674.1 class 1 isoprenoid biosynthesis enzyme Regulator
  KJP47_RS17100 (NRS6120_17645) degQ 3173209..3173349 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP47_RS17105 - 3173571..3173696 (+) 126 WP_003228793.1 hypothetical protein -
  KJP47_RS17110 (NRS6120_17650) - 3173810..3174178 (+) 369 WP_014477834.1 hypothetical protein -
  KJP47_RS17115 (NRS6120_17655) pdeH 3174154..3175383 (-) 1230 WP_041057592.1 cyclic di-GMP phosphodiesterase -
  KJP47_RS17120 (NRS6120_17660) pncB 3175520..3176992 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP47_RS17125 (NRS6120_17665) pncA 3177008..3177559 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  KJP47_RS17130 (NRS6120_17670) yueI 3177656..3178054 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1157772 KJP47_RS17100 WP_003220708.1 3173209..3173349(-) (degQ) [Bacillus subtilis isolate NRS6120]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1157772 KJP47_RS17100 WP_003220708.1 3173209..3173349(-) (degQ) [Bacillus subtilis isolate NRS6120]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment