Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   KJP47_RS13225 Genome accession   NZ_OX419577
Coordinates   2457322..2457669 (-) Length   115 a.a.
NCBI ID   WP_213381625.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6120     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2452322..2462669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP47_RS13180 (NRS6120_13715) sinI 2452855..2453028 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP47_RS13185 (NRS6120_13720) sinR 2453062..2453397 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP47_RS13190 (NRS6120_13725) tasA 2453490..2454275 (-) 786 WP_213381649.1 TasA family protein -
  KJP47_RS13195 (NRS6120_13730) sipW 2454340..2454912 (-) 573 WP_213381733.1 signal peptidase I -
  KJP47_RS13200 (NRS6120_13735) tapA 2454896..2455651 (-) 756 WP_213381630.1 amyloid fiber anchoring/assembly protein TapA -
  KJP47_RS13205 (NRS6120_13740) yqzG 2455923..2456249 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  KJP47_RS13210 (NRS6120_13745) spoIIT 2456291..2456470 (-) 180 WP_003230176.1 YqzE family protein -
  KJP47_RS13215 (NRS6120_13750) comGG 2456541..2456915 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  KJP47_RS13220 (NRS6120_13755) comGF 2456916..2457296 (-) 381 WP_213381628.1 competence type IV pilus minor pilin ComGF Machinery gene
  KJP47_RS13225 (NRS6120_13760) comGE 2457322..2457669 (-) 348 WP_213381625.1 competence type IV pilus minor pilin ComGE Machinery gene
  KJP47_RS13230 (NRS6120_13765) comGD 2457653..2458084 (-) 432 WP_213381623.1 competence type IV pilus minor pilin ComGD Machinery gene
  KJP47_RS13235 (NRS6120_13770) comGC 2458074..2458370 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KJP47_RS13240 (NRS6120_13775) comGB 2458384..2459421 (-) 1038 WP_121590958.1 competence type IV pilus assembly protein ComGB Machinery gene
  KJP47_RS13245 (NRS6120_13780) comGA 2459408..2460478 (-) 1071 WP_213381621.1 competence type IV pilus ATPase ComGA Machinery gene
  KJP47_RS13250 - 2460689..2460835 (-) 147 WP_282248560.1 hypothetical protein -
  KJP47_RS13255 (NRS6120_13785) corA 2460888..2461841 (-) 954 WP_087961337.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13046.93 Da        Isoelectric Point: 4.4864

>NTDB_id=1157751 KJP47_RS13225 WP_213381625.1 2457322..2457669(-) (comGE) [Bacillus subtilis isolate NRS6120]
MWIGSKGFSTIETMSALSLWLFVLLAVVPLWDKLIADENMAESREIGYQMMNESISKYVMTGEGAASKTMTRNNHTYAMT
WEEEGEYQNVCISAAAYKEKSFCLSILQTEWLHAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=1157751 KJP47_RS13225 WP_213381625.1 2457322..2457669(-) (comGE) [Bacillus subtilis isolate NRS6120]
ATGTGGATAGGAAGTAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTATGGCTGTTTGTGCTGCTGGCAGT
TGTTCCCTTGTGGGACAAGCTGATAGCTGATGAAAATATGGCGGAATCACGAGAAATCGGTTATCAGATGATGAATGAGA
GCATTAGCAAATATGTCATGACTGGTGAAGGAGCCGCGTCAAAAACGATGACAAGAAACAACCATACCTATGCTATGACG
TGGGAGGAGGAGGGCGAATATCAAAACGTATGCATCTCAGCGGCAGCTTATAAAGAAAAATCATTTTGCCTCAGCATTCT
GCAGACAGAATGGCTACACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

89.565

100

0.896

Multiple sequence alignment