Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KJP47_RS13180 | Genome accession | NZ_OX419577 |
| Coordinates | 2452855..2453028 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis isolate NRS6120 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2447855..2458028
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP47_RS13165 (NRS6120_13700) | gcvT | 2448653..2449741 (-) | 1089 | WP_213381652.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KJP47_RS13170 (NRS6120_13705) | yqhH | 2450183..2451856 (+) | 1674 | WP_213381651.1 | SNF2-related protein | - |
| KJP47_RS13175 (NRS6120_13710) | yqhG | 2451877..2452671 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| KJP47_RS13180 (NRS6120_13715) | sinI | 2452855..2453028 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| KJP47_RS13185 (NRS6120_13720) | sinR | 2453062..2453397 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| KJP47_RS13190 (NRS6120_13725) | tasA | 2453490..2454275 (-) | 786 | WP_213381649.1 | TasA family protein | - |
| KJP47_RS13195 (NRS6120_13730) | sipW | 2454340..2454912 (-) | 573 | WP_213381733.1 | signal peptidase I | - |
| KJP47_RS13200 (NRS6120_13735) | tapA | 2454896..2455651 (-) | 756 | WP_213381630.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KJP47_RS13205 (NRS6120_13740) | yqzG | 2455923..2456249 (+) | 327 | WP_026113671.1 | YqzG/YhdC family protein | - |
| KJP47_RS13210 (NRS6120_13745) | spoIIT | 2456291..2456470 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| KJP47_RS13215 (NRS6120_13750) | comGG | 2456541..2456915 (-) | 375 | WP_032726157.1 | ComG operon protein ComGG | Machinery gene |
| KJP47_RS13220 (NRS6120_13755) | comGF | 2456916..2457296 (-) | 381 | WP_213381628.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| KJP47_RS13225 (NRS6120_13760) | comGE | 2457322..2457669 (-) | 348 | WP_213381625.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=1157747 KJP47_RS13180 WP_003230187.1 2452855..2453028(+) (sinI) [Bacillus subtilis isolate NRS6120]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1157747 KJP47_RS13180 WP_003230187.1 2452855..2453028(+) (sinI) [Bacillus subtilis isolate NRS6120]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |