Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP47_RS13180 Genome accession   NZ_OX419577
Coordinates   2452855..2453028 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6120     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2447855..2458028
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP47_RS13165 (NRS6120_13700) gcvT 2448653..2449741 (-) 1089 WP_213381652.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP47_RS13170 (NRS6120_13705) yqhH 2450183..2451856 (+) 1674 WP_213381651.1 SNF2-related protein -
  KJP47_RS13175 (NRS6120_13710) yqhG 2451877..2452671 (+) 795 WP_003230200.1 YqhG family protein -
  KJP47_RS13180 (NRS6120_13715) sinI 2452855..2453028 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP47_RS13185 (NRS6120_13720) sinR 2453062..2453397 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP47_RS13190 (NRS6120_13725) tasA 2453490..2454275 (-) 786 WP_213381649.1 TasA family protein -
  KJP47_RS13195 (NRS6120_13730) sipW 2454340..2454912 (-) 573 WP_213381733.1 signal peptidase I -
  KJP47_RS13200 (NRS6120_13735) tapA 2454896..2455651 (-) 756 WP_213381630.1 amyloid fiber anchoring/assembly protein TapA -
  KJP47_RS13205 (NRS6120_13740) yqzG 2455923..2456249 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  KJP47_RS13210 (NRS6120_13745) spoIIT 2456291..2456470 (-) 180 WP_003230176.1 YqzE family protein -
  KJP47_RS13215 (NRS6120_13750) comGG 2456541..2456915 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  KJP47_RS13220 (NRS6120_13755) comGF 2456916..2457296 (-) 381 WP_213381628.1 competence type IV pilus minor pilin ComGF Machinery gene
  KJP47_RS13225 (NRS6120_13760) comGE 2457322..2457669 (-) 348 WP_213381625.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1157747 KJP47_RS13180 WP_003230187.1 2452855..2453028(+) (sinI) [Bacillus subtilis isolate NRS6120]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1157747 KJP47_RS13180 WP_003230187.1 2452855..2453028(+) (sinI) [Bacillus subtilis isolate NRS6120]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment