Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KJP57_RS13745 Genome accession   NZ_OX419573
Coordinates   2609616..2609990 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis isolate NRS6085     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2604616..2614990
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP57_RS13705 (NRS6085_13715) yqhG 2604947..2605741 (+) 795 WP_003230200.1 YqhG family protein -
  KJP57_RS13710 (NRS6085_13720) sinI 2605924..2606097 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP57_RS13715 (NRS6085_13725) sinR 2606131..2606466 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP57_RS13720 (NRS6085_13730) tasA 2606559..2607344 (-) 786 WP_128738018.1 biofilm matrix protein TasA -
  KJP57_RS13725 (NRS6085_13735) sipW 2607408..2607980 (-) 573 WP_128738626.1 signal peptidase I -
  KJP57_RS13730 (NRS6085_13740) tapA 2607964..2608725 (-) 762 WP_101169542.1 amyloid fiber anchoring/assembly protein TapA -
  KJP57_RS13735 (NRS6085_13745) yqzG 2608998..2609324 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  KJP57_RS13740 (NRS6085_13750) spoIIT 2609366..2609545 (-) 180 WP_014480252.1 YqzE family protein -
  KJP57_RS13745 (NRS6085_13755) comGG 2609616..2609990 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KJP57_RS13750 (NRS6085_13760) comGF 2609991..2610374 (-) 384 WP_128738019.1 ComG operon protein ComGF Machinery gene
  KJP57_RS13755 (NRS6085_13765) comGE 2610400..2610747 (-) 348 WP_128738020.1 ComG operon protein 5 Machinery gene
  KJP57_RS13760 (NRS6085_13770) comGD 2610731..2611162 (-) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  KJP57_RS13765 (NRS6085_13775) comGC 2611152..2611448 (-) 297 WP_024573391.1 comG operon protein ComGC Machinery gene
  KJP57_RS13770 (NRS6085_13780) comGB 2611462..2612499 (-) 1038 WP_128738021.1 comG operon protein ComGB Machinery gene
  KJP57_RS13775 (NRS6085_13785) comGA 2612486..2613556 (-) 1071 WP_128738022.1 competence protein ComGA Machinery gene
  KJP57_RS13780 - 2613767..2613892 (-) 126 WP_003230155.1 hypothetical protein -
  KJP57_RS13785 (NRS6085_13790) corA 2613958..2614911 (-) 954 WP_213407806.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=1157503 KJP57_RS13745 WP_014480253.1 2609616..2609990(-) (comGG) [Bacillus subtilis isolate NRS6085]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1157503 KJP57_RS13745 WP_014480253.1 2609616..2609990(-) (comGG) [Bacillus subtilis isolate NRS6085]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment