Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP42_RS12465 Genome accession   NZ_OX419567
Coordinates   2438081..2438254 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6107     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2433081..2443254
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP42_RS12450 (NRS6107_12385) gcvT 2433880..2434968 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP42_RS12455 (NRS6107_12390) yqhH 2435410..2437083 (+) 1674 WP_004398544.1 SNF2-related protein -
  KJP42_RS12460 (NRS6107_12395) yqhG 2437104..2437898 (+) 795 WP_003230200.1 YqhG family protein -
  KJP42_RS12465 (NRS6107_12400) sinI 2438081..2438254 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP42_RS12470 (NRS6107_12405) sinR 2438288..2438623 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP42_RS12475 (NRS6107_12410) tasA 2438716..2439501 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP42_RS12480 (NRS6107_12415) sipW 2439565..2440137 (-) 573 WP_003246088.1 signal peptidase I -
  KJP42_RS12485 (NRS6107_12420) tapA 2440121..2440882 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  KJP42_RS12490 (NRS6107_12425) yqzG 2441154..2441480 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP42_RS12495 (NRS6107_12430) spoIIT 2441522..2441701 (-) 180 WP_003230176.1 YqzE family protein -
  KJP42_RS12500 (NRS6107_12435) comGG 2441772..2442146 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP42_RS12505 (NRS6107_12440) comGF 2442147..2442530 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP42_RS12510 (NRS6107_12445) comGE 2442556..2442903 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1157248 KJP42_RS12465 WP_003230187.1 2438081..2438254(+) (sinI) [Bacillus subtilis isolate NRS6107]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1157248 KJP42_RS12465 WP_003230187.1 2438081..2438254(+) (sinI) [Bacillus subtilis isolate NRS6107]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment