Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KJP42_RS12505 Genome accession   NZ_OX419567
Coordinates   2442147..2442530 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6107     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2437147..2447530
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP42_RS12465 (NRS6107_12400) sinI 2438081..2438254 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP42_RS12470 (NRS6107_12405) sinR 2438288..2438623 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP42_RS12475 (NRS6107_12410) tasA 2438716..2439501 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP42_RS12480 (NRS6107_12415) sipW 2439565..2440137 (-) 573 WP_003246088.1 signal peptidase I -
  KJP42_RS12485 (NRS6107_12420) tapA 2440121..2440882 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  KJP42_RS12490 (NRS6107_12425) yqzG 2441154..2441480 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP42_RS12495 (NRS6107_12430) spoIIT 2441522..2441701 (-) 180 WP_003230176.1 YqzE family protein -
  KJP42_RS12500 (NRS6107_12435) comGG 2441772..2442146 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP42_RS12505 (NRS6107_12440) comGF 2442147..2442530 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP42_RS12510 (NRS6107_12445) comGE 2442556..2442903 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  KJP42_RS12515 (NRS6107_12450) comGD 2442887..2443318 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  KJP42_RS12520 (NRS6107_12455) comGC 2443308..2443604 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KJP42_RS12525 (NRS6107_12460) comGB 2443618..2444655 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  KJP42_RS12530 (NRS6107_12465) comGA 2444642..2445712 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP42_RS12535 (NRS6107_12475) corA 2446124..2447077 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=1157251 KJP42_RS12505 WP_003230168.1 2442147..2442530(-) (comGF) [Bacillus subtilis isolate NRS6107]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1157251 KJP42_RS12505 WP_003230168.1 2442147..2442530(-) (comGF) [Bacillus subtilis isolate NRS6107]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment