Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP77_RS13370 Genome accession   NZ_OX419554
Coordinates   2552086..2552259 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6160     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547086..2557259
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP77_RS13355 (NRS6160_13205) gcvT 2547885..2548973 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP77_RS13360 (NRS6160_13210) yqhH 2549415..2551088 (+) 1674 WP_003230203.1 SNF2-related protein -
  KJP77_RS13365 (NRS6160_13215) yqhG 2551109..2551903 (+) 795 WP_015714249.1 YqhG family protein -
  KJP77_RS13370 (NRS6160_13220) sinI 2552086..2552259 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP77_RS13375 (NRS6160_13225) sinR 2552293..2552628 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP77_RS13380 (NRS6160_13230) tasA 2552721..2553506 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  KJP77_RS13385 (NRS6160_13235) sipW 2553570..2554142 (-) 573 WP_003230181.1 signal peptidase I -
  KJP77_RS13390 (NRS6160_13240) tapA 2554126..2554887 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  KJP77_RS13395 (NRS6160_13245) yqzG 2555157..2555483 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP77_RS13400 (NRS6160_13250) spoIIT 2555525..2555704 (-) 180 WP_072175549.1 YqzE family protein -
  KJP77_RS13405 (NRS6160_13255) comGG 2555775..2556149 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  KJP77_RS13410 comGF 2556150..2556533 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  KJP77_RS13415 (NRS6160_13265) comGE 2556559..2556906 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1156599 KJP77_RS13370 WP_003230187.1 2552086..2552259(+) (sinI) [Bacillus subtilis isolate NRS6160]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1156599 KJP77_RS13370 WP_003230187.1 2552086..2552259(+) (sinI) [Bacillus subtilis isolate NRS6160]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment