Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KJP77_RS13405 Genome accession   NZ_OX419554
Coordinates   2555775..2556149 (-) Length   124 a.a.
NCBI ID   WP_015714252.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6160     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2550775..2561149
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP77_RS13365 (NRS6160_13215) yqhG 2551109..2551903 (+) 795 WP_015714249.1 YqhG family protein -
  KJP77_RS13370 (NRS6160_13220) sinI 2552086..2552259 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP77_RS13375 (NRS6160_13225) sinR 2552293..2552628 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP77_RS13380 (NRS6160_13230) tasA 2552721..2553506 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  KJP77_RS13385 (NRS6160_13235) sipW 2553570..2554142 (-) 573 WP_003230181.1 signal peptidase I -
  KJP77_RS13390 (NRS6160_13240) tapA 2554126..2554887 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  KJP77_RS13395 (NRS6160_13245) yqzG 2555157..2555483 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP77_RS13400 (NRS6160_13250) spoIIT 2555525..2555704 (-) 180 WP_072175549.1 YqzE family protein -
  KJP77_RS13405 (NRS6160_13255) comGG 2555775..2556149 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  KJP77_RS13410 comGF 2556150..2556533 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  KJP77_RS13415 (NRS6160_13265) comGE 2556559..2556906 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  KJP77_RS13420 (NRS6160_13270) comGD 2556890..2557321 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  KJP77_RS13425 (NRS6160_13275) comGC 2557311..2557607 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KJP77_RS13430 (NRS6160_13280) comGB 2557621..2558658 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  KJP77_RS13435 (NRS6160_13285) comGA 2558645..2559715 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  KJP77_RS13440 (NRS6160_13290) - 2559927..2560124 (-) 198 WP_213416101.1 hypothetical protein -
  KJP77_RS13445 (NRS6160_13295) corA 2560126..2561079 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14524.73 Da        Isoelectric Point: 8.7849

>NTDB_id=1156601 KJP77_RS13405 WP_015714252.1 2555775..2556149(-) (comGG) [Bacillus subtilis isolate NRS6160]
MYRTRGFIYPAILFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1156601 KJP77_RS13405 WP_015714252.1 2555775..2556149(-) (comGG) [Bacillus subtilis isolate NRS6160]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCAATTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGGACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96

Multiple sequence alignment