Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KJP78_RS17510 Genome accession   NZ_OX419553
Coordinates   3299306..3299446 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6183     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3294306..3304446
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP78_RS17485 (NRS6183_17350) yuxO 3294619..3294999 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  KJP78_RS17490 (NRS6183_17355) comA 3295018..3295662 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP78_RS17495 (NRS6183_17360) comP 3295743..3298052 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP78_RS17500 (NRS6183_17365) comX 3298067..3298234 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KJP78_RS17505 (NRS6183_17370) comQ 3298222..3299121 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP78_RS17510 (NRS6183_17375) degQ 3299306..3299446 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP78_RS17515 - 3299668..3299793 (+) 126 WP_003228793.1 hypothetical protein -
  KJP78_RS17520 (NRS6183_17380) - 3299907..3300275 (+) 369 WP_014477834.1 hypothetical protein -
  KJP78_RS17525 (NRS6183_17385) pdeH 3300251..3301480 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  KJP78_RS17530 (NRS6183_17390) pncB 3301617..3303089 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP78_RS17535 (NRS6183_17395) pncA 3303105..3303656 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  KJP78_RS17540 (NRS6183_17400) yueI 3303753..3304151 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1156544 KJP78_RS17510 WP_003220708.1 3299306..3299446(-) (degQ) [Bacillus subtilis isolate NRS6183]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1156544 KJP78_RS17510 WP_003220708.1 3299306..3299446(-) (degQ) [Bacillus subtilis isolate NRS6183]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment