Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KJP78_RS13585 Genome accession   NZ_OX419553
Coordinates   2582620..2582994 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6183     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2577620..2587994
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP78_RS13545 (NRS6183_13465) yqhG 2577951..2578745 (+) 795 WP_015714249.1 YqhG family protein -
  KJP78_RS13550 (NRS6183_13470) sinI 2578928..2579101 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP78_RS13555 (NRS6183_13475) sinR 2579135..2579470 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP78_RS13560 (NRS6183_13480) tasA 2579563..2580348 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP78_RS13565 (NRS6183_13485) sipW 2580412..2580984 (-) 573 WP_072692741.1 signal peptidase I -
  KJP78_RS13570 (NRS6183_13490) tapA 2580968..2581729 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP78_RS13575 (NRS6183_13495) yqzG 2582001..2582327 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP78_RS13580 (NRS6183_13500) spoIIT 2582369..2582548 (-) 180 WP_029726723.1 YqzE family protein -
  KJP78_RS13585 (NRS6183_13505) comGG 2582620..2582994 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP78_RS13590 (NRS6183_13510) comGF 2582995..2583378 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP78_RS13595 (NRS6183_13515) comGE 2583404..2583751 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  KJP78_RS13600 (NRS6183_13520) comGD 2583735..2584166 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP78_RS13605 (NRS6183_13525) comGC 2584156..2584452 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP78_RS13610 (NRS6183_13530) comGB 2584466..2585503 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  KJP78_RS13615 (NRS6183_13535) comGA 2585490..2586560 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP78_RS13620 (NRS6183_13545) - 2586773..2586970 (-) 198 WP_029726717.1 hypothetical protein -
  KJP78_RS13625 (NRS6183_13550) corA 2586972..2587925 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=1156520 KJP78_RS13585 WP_029726722.1 2582620..2582994(-) (comGG) [Bacillus subtilis isolate NRS6183]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1156520 KJP78_RS13585 WP_029726722.1 2582620..2582994(-) (comGG) [Bacillus subtilis isolate NRS6183]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment