Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP78_RS13550 Genome accession   NZ_OX419553
Coordinates   2578928..2579101 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6183     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2573928..2584101
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP78_RS13535 (NRS6183_13455) gcvT 2574728..2575816 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP78_RS13540 (NRS6183_13460) yqhH 2576257..2577930 (+) 1674 WP_029726726.1 SNF2-related protein -
  KJP78_RS13545 (NRS6183_13465) yqhG 2577951..2578745 (+) 795 WP_015714249.1 YqhG family protein -
  KJP78_RS13550 (NRS6183_13470) sinI 2578928..2579101 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP78_RS13555 (NRS6183_13475) sinR 2579135..2579470 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP78_RS13560 (NRS6183_13480) tasA 2579563..2580348 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  KJP78_RS13565 (NRS6183_13485) sipW 2580412..2580984 (-) 573 WP_072692741.1 signal peptidase I -
  KJP78_RS13570 (NRS6183_13490) tapA 2580968..2581729 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP78_RS13575 (NRS6183_13495) yqzG 2582001..2582327 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP78_RS13580 (NRS6183_13500) spoIIT 2582369..2582548 (-) 180 WP_029726723.1 YqzE family protein -
  KJP78_RS13585 (NRS6183_13505) comGG 2582620..2582994 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  KJP78_RS13590 (NRS6183_13510) comGF 2582995..2583378 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  KJP78_RS13595 (NRS6183_13515) comGE 2583404..2583751 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1156518 KJP78_RS13550 WP_003230187.1 2578928..2579101(+) (sinI) [Bacillus subtilis isolate NRS6183]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1156518 KJP78_RS13550 WP_003230187.1 2578928..2579101(+) (sinI) [Bacillus subtilis isolate NRS6183]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment