Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | QML75_RS00070 | Genome accession | NZ_OX346408 |
| Coordinates | 14627..15145 (+) | Length | 172 a.a. |
| NCBI ID | WP_016250467.1 | Uniprot ID | A0A0H2QMK6 |
| Organism | Enterococcus cecorum isolate CIRMBP-1302 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 14523..84218 | 14627..15145 | within | 0 |
Gene organization within MGE regions
Location: 14523..84218
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QML75_RS00070 (CIRMBP1302_00014) | ssb | 14627..15145 (+) | 519 | WP_016250467.1 | single-stranded DNA-binding protein | Machinery gene |
| QML75_RS00075 (CIRMBP1302_00015) | rpsR | 15175..15411 (+) | 237 | WP_016250466.1 | 30S ribosomal protein S18 | - |
| QML75_RS00080 (CIRMBP1302_00016) | - | 15600..16013 (+) | 414 | WP_016250465.1 | NUDIX hydrolase | - |
| QML75_RS00085 (CIRMBP1302_00017) | - | 16050..16364 (+) | 315 | WP_235426786.1 | NAD(P)H-dependent oxidoreductase | - |
| QML75_RS00090 (CIRMBP1302_00018) | - | 16590..20429 (+) | 3840 | WP_016250463.1 | YSIRK signal domain/LPXTG anchor domain surface protein | - |
| QML75_RS00095 (CIRMBP1302_00019) | - | 20638..22089 (+) | 1452 | WP_050047225.1 | DHH family phosphoesterase | - |
| QML75_RS00100 (CIRMBP1302_00020) | rplI | 22102..22554 (+) | 453 | WP_016250461.1 | 50S ribosomal protein L9 | - |
| QML75_RS00105 (CIRMBP1302_00021) | - | 22761..23093 (+) | 333 | WP_018345237.1 | hypothetical protein | - |
| QML75_RS00110 (CIRMBP1302_00022) | dnaB | 23250..24620 (+) | 1371 | WP_016250459.1 | replicative DNA helicase | - |
| QML75_RS00115 (CIRMBP1302_00023) | - | 24670..24990 (-) | 321 | WP_047241755.1 | hypothetical protein | - |
| QML75_RS00120 (CIRMBP1302_00024) | - | 25410..27578 (+) | 2169 | WP_016250457.1 | PTS transporter subunit IIBC | - |
| QML75_RS00125 (CIRMBP1302_00025) | - | 27679..28476 (+) | 798 | WP_047241753.1 | endonuclease/exonuclease/phosphatase family protein | - |
| QML75_RS00130 (CIRMBP1302_00026) | - | 28735..30027 (+) | 1293 | WP_047241769.1 | adenylosuccinate synthase | - |
| QML75_RS00135 (CIRMBP1302_00027) | - | 30451..30660 (+) | 210 | WP_152666054.1 | hypothetical protein | - |
| QML75_RS00140 (CIRMBP1302_00028) | - | 30913..31320 (+) | 408 | WP_235426086.1 | hypothetical protein | - |
| QML75_RS00145 (CIRMBP1302_00029) | - | 31593..32795 (-) | 1203 | WP_047241751.1 | MFS transporter | - |
| QML75_RS00150 (CIRMBP1302_00030) | - | 33108..34739 (-) | 1632 | WP_016250453.1 | ATP-binding cassette domain-containing protein | - |
| QML75_RS00155 (CIRMBP1302_00031) | - | 35186..35518 (+) | 333 | WP_016250439.1 | PTS sugar transporter subunit IIB | - |
| QML75_RS00160 (CIRMBP1302_00032) | - | 35538..35900 (+) | 363 | WP_016250438.1 | PTS lactose/cellobiose transporter subunit IIA | - |
| QML75_RS00165 (CIRMBP1302_00033) | - | 35959..37047 (+) | 1089 | WP_047241768.1 | MupG family TIM beta-alpha barrel fold protein | - |
| QML75_RS00170 (CIRMBP1302_00034) | - | 37237..38613 (+) | 1377 | WP_050047223.1 | 6-phospho-beta-glucosidase | - |
| QML75_RS00175 | - | 38753..39040 (+) | 288 | Protein_34 | DUF871 domain-containing protein | - |
| QML75_RS00180 (CIRMBP1302_00035) | - | 39311..40747 (+) | 1437 | WP_047241748.1 | 6-phospho-beta-glucosidase | - |
| QML75_RS00185 (CIRMBP1302_00036) | - | 40812..41306 (+) | 495 | WP_047241747.1 | hypothetical protein | - |
| QML75_RS00190 (CIRMBP1302_00037) | celB | 41329..42675 (+) | 1347 | WP_047241746.1 | PTS cellobiose transporter subunit IIC | - |
| QML75_RS00195 (CIRMBP1302_00038) | - | 42922..44139 (-) | 1218 | WP_001291561.1 | tyrosine-type recombinase/integrase | - |
| QML75_RS00200 (CIRMBP1302_00039) | - | 44221..44424 (-) | 204 | WP_000814511.1 | excisionase | - |
| QML75_RS00205 | - | 44408..44659 (+) | 252 | WP_001845478.1 | hypothetical protein | - |
| QML75_RS00210 (CIRMBP1302_00040) | - | 44885..45115 (-) | 231 | WP_000857133.1 | helix-turn-helix domain-containing protein | - |
| QML75_RS00215 (CIRMBP1302_00041) | - | 45112..45534 (-) | 423 | WP_000804885.1 | sigma-70 family RNA polymerase sigma factor | - |
| QML75_RS00220 (CIRMBP1302_00042) | - | 46038..46391 (+) | 354 | WP_001227347.1 | helix-turn-helix transcriptional regulator | - |
| QML75_RS00225 | - | 46451..46582 (-) | 132 | WP_080961458.1 | cysteine-rich KTR domain-containing protein | - |
| QML75_RS00230 (CIRMBP1302_00043) | - | 46610..47176 (-) | 567 | WP_047241745.1 | GNAT family protein | - |
| QML75_RS00235 (CIRMBP1302_00044) | tet(M) | 47349..49268 (-) | 1920 | WP_047241744.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| QML75_RS00240 | - | 49284..49400 (-) | 117 | WP_001814923.1 | tetracycline resistance determinant leader peptide | - |
| QML75_RS00245 (CIRMBP1302_00045) | - | 49645..50577 (-) | 933 | WP_001224318.1 | conjugal transfer protein | - |
| QML75_RS00250 (CIRMBP1302_00046) | - | 50574..51575 (-) | 1002 | WP_000769868.1 | bifunctional lysozyme/C40 family peptidase | - |
| QML75_RS00255 (CIRMBP1302_00047) | - | 51572..53749 (-) | 2178 | WP_282007801.1 | YtxH domain-containing protein | - |
| QML75_RS00260 (CIRMBP1302_00048) | - | 53752..56199 (-) | 2448 | WP_047241742.1 | ATP-binding protein | - |
| QML75_RS00265 | - | 56183..56575 (-) | 393 | WP_000723888.1 | conjugal transfer protein | - |
| QML75_RS00270 (CIRMBP1302_00049) | - | 56664..57161 (-) | 498 | WP_000342539.1 | antirestriction protein ArdA | - |
| QML75_RS00275 (CIRMBP1302_00050) | - | 57278..57499 (-) | 222 | WP_001009056.1 | hypothetical protein | - |
| QML75_RS00280 (CIRMBP1302_00051) | mobT | 57542..58747 (-) | 1206 | WP_000398284.1 | MobT family relaxase | - |
| QML75_RS00285 | - | 58770..58922 (-) | 153 | WP_000879507.1 | hypothetical protein | - |
| QML75_RS00290 (CIRMBP1302_00052) | - | 58925..60310 (-) | 1386 | WP_000813488.1 | FtsK/SpoIIIE domain-containing protein | - |
| QML75_RS00295 (CIRMBP1302_00053) | - | 60339..60725 (-) | 387 | WP_000985015.1 | YdcP family protein | - |
| QML75_RS00300 (CIRMBP1302_00054) | - | 60741..61055 (-) | 315 | WP_000420682.1 | YdcP family protein | - |
| QML75_RS00305 (CIRMBP1302_00055) | - | 61433..62146 (-) | 714 | WP_047241741.1 | GntR family transcriptional regulator | - |
| QML75_RS00310 (CIRMBP1302_00056) | - | 62326..63807 (+) | 1482 | WP_047241740.1 | family 1 glycosylhydrolase | - |
| QML75_RS00315 (CIRMBP1302_00057) | - | 63854..65101 (-) | 1248 | WP_047241739.1 | glutamate-5-semialdehyde dehydrogenase | - |
| QML75_RS00320 (CIRMBP1302_00058) | proB | 65117..65920 (-) | 804 | WP_235426847.1 | glutamate 5-kinase | - |
| QML75_RS11830 | - | 66054..66221 (-) | 168 | WP_326929994.1 | hypothetical protein | - |
| QML75_RS11835 (CIRMBP1302_00059) | - | 66236..66505 (-) | 270 | WP_326929993.1 | hypothetical protein | - |
| QML75_RS11840 (CIRMBP1302_00060) | - | 66456..66746 (-) | 291 | WP_326929961.1 | hypothetical protein | - |
| QML75_RS00330 (CIRMBP1302_00061) | - | 66969..67490 (+) | 522 | WP_047241737.1 | hypothetical protein | - |
| QML75_RS00335 (CIRMBP1302_00062) | radA | 67503..68873 (+) | 1371 | WP_047241736.1 | DNA repair protein RadA | Machinery gene |
| QML75_RS00340 (CIRMBP1302_00063) | - | 69073..70179 (+) | 1107 | WP_016250426.1 | PIN/TRAM domain-containing protein | - |
| QML75_RS00345 (CIRMBP1302_00064) | rfbC | 70219..70776 (+) | 558 | WP_047241735.1 | dTDP-4-dehydrorhamnose 3,5-epimerase | - |
| QML75_RS00350 (CIRMBP1302_00065) | - | 70992..71297 (+) | 306 | WP_047241734.1 | hypothetical protein | - |
| QML75_RS00355 (CIRMBP1302_00066) | - | 71466..71702 (+) | 237 | WP_235426088.1 | GNAT family N-acetyltransferase | - |
| QML75_RS00360 (CIRMBP1302_00067) | gltX | 71938..73395 (+) | 1458 | WP_047241733.1 | glutamate--tRNA ligase | - |
| QML75_RS00365 (CIRMBP1302_00068) | epsC | 73820..74353 (+) | 534 | WP_016250421.1 | serine O-acetyltransferase EpsC | - |
| QML75_RS00370 (CIRMBP1302_00069) | cysS | 74346..75752 (+) | 1407 | WP_047241732.1 | cysteine--tRNA ligase | - |
| QML75_RS00375 (CIRMBP1302_00070) | - | 75752..76144 (+) | 393 | WP_016250419.1 | Mini-ribonuclease 3 | - |
| QML75_RS00380 (CIRMBP1302_00071) | rlmB | 76141..76944 (+) | 804 | WP_047241731.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| QML75_RS00385 (CIRMBP1302_00072) | - | 76948..77484 (+) | 537 | WP_047241730.1 | NYN domain-containing protein | - |
| QML75_RS00390 | - | 77665..77880 (+) | 216 | Protein_79 | sigma factor | - |
| QML75_RS00395 | - | 77884..78066 (+) | 183 | Protein_80 | transposase | - |
| QML75_RS00400 (CIRMBP1302_00075) | tnpB | 78083..79225 (+) | 1143 | WP_047241729.1 | IS200/IS605 family element RNA-guided endonuclease TnpB | - |
| QML75_RS00405 | - | 79521..79688 (+) | 168 | WP_160297721.1 | hypothetical protein | - |
| QML75_RS00410 (CIRMBP1302_00076) | pgmB | 79733..80383 (-) | 651 | WP_047241728.1 | beta-phosphoglucomutase | - |
| QML75_RS00415 (CIRMBP1302_00077) | - | 80534..80743 (+) | 210 | WP_047241727.1 | hypothetical protein | - |
| QML75_RS00420 (CIRMBP1302_00078) | thiT | 81007..81585 (+) | 579 | WP_047241726.1 | energy-coupled thiamine transporter ThiT | - |
| QML75_RS00425 (CIRMBP1302_00079) | - | 81654..82610 (-) | 957 | WP_050047220.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
Sequence
Protein
Download Length: 172 a.a. Molecular weight: 19042.89 Da Isoelectric Point: 4.7093
>NTDB_id=1155187 QML75_RS00070 WP_016250467.1 14627..15145(+) (ssb) [Enterococcus cecorum isolate CIRMBP-1302]
MINNVVLVGRLTRDPDLRYTSSGVAVATFSLAVNRNFTSQNGERETDFINCVIWRKPAETLANYARKGTLIGLTGRIQTR
NYENQQGQRVYVTEVVADNFQLLESKAVNDQRRQAAGNFDNNVSQPFNNNNNSFDQPASSQPFSGMPGFDRDASNTPLGG
SSIDISDDDLPF
MINNVVLVGRLTRDPDLRYTSSGVAVATFSLAVNRNFTSQNGERETDFINCVIWRKPAETLANYARKGTLIGLTGRIQTR
NYENQQGQRVYVTEVVADNFQLLESKAVNDQRRQAAGNFDNNVSQPFNNNNNSFDQPASSQPFSGMPGFDRDASNTPLGG
SSIDISDDDLPF
Nucleotide
Download Length: 519 bp
>NTDB_id=1155187 QML75_RS00070 WP_016250467.1 14627..15145(+) (ssb) [Enterococcus cecorum isolate CIRMBP-1302]
TTGATTAATAATGTTGTATTAGTAGGTAGATTAACAAGAGACCCTGATTTACGTTACACTTCTTCTGGTGTTGCGGTGGC
TACTTTTAGTTTAGCTGTGAACCGTAATTTTACCAGCCAAAATGGAGAAAGAGAAACGGACTTTATCAATTGTGTCATTT
GGCGTAAACCAGCTGAAACCTTAGCAAATTACGCTAGAAAAGGGACATTAATTGGTTTGACCGGACGTATTCAAACGAGA
AATTATGAAAACCAACAAGGTCAACGTGTATACGTAACTGAAGTGGTTGCCGATAATTTCCAATTATTAGAGTCTAAAGC
AGTCAACGATCAACGTCGTCAAGCTGCCGGAAACTTTGATAATAATGTCTCACAACCATTTAACAATAATAACAATAGCT
TTGATCAGCCAGCTTCATCTCAACCATTTAGTGGAATGCCTGGCTTTGACCGTGATGCAAGTAACACACCACTTGGCGGA
TCAAGCATTGACATTTCAGATGATGATTTACCATTCTAA
TTGATTAATAATGTTGTATTAGTAGGTAGATTAACAAGAGACCCTGATTTACGTTACACTTCTTCTGGTGTTGCGGTGGC
TACTTTTAGTTTAGCTGTGAACCGTAATTTTACCAGCCAAAATGGAGAAAGAGAAACGGACTTTATCAATTGTGTCATTT
GGCGTAAACCAGCTGAAACCTTAGCAAATTACGCTAGAAAAGGGACATTAATTGGTTTGACCGGACGTATTCAAACGAGA
AATTATGAAAACCAACAAGGTCAACGTGTATACGTAACTGAAGTGGTTGCCGATAATTTCCAATTATTAGAGTCTAAAGC
AGTCAACGATCAACGTCGTCAAGCTGCCGGAAACTTTGATAATAATGTCTCACAACCATTTAACAATAATAACAATAGCT
TTGATCAGCCAGCTTCATCTCAACCATTTAGTGGAATGCCTGGCTTTGACCGTGATGCAAGTAACACACCACTTGGCGGA
TCAAGCATTGACATTTCAGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
60.345 |
100 |
0.61 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.409 |
100 |
0.547 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
61.628 |
0.366 |