Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   QML77_RS00200 Genome accession   NZ_OX346407
Coordinates   38458..38976 (+) Length   172 a.a.
NCBI ID   WP_016250467.1    Uniprot ID   A0A0H2QMK6
Organism   Enterococcus cecorum isolate CIRMBP-1274     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2656..74156 38458..38976 within 0


Gene organization within MGE regions


Location: 2656..74156
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QML77_RS00015 (CIRMBP1274_00003) - 3104..3259 (+) 156 WP_281956900.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
  QML77_RS00020 (CIRMBP1274_00004) - 3405..4307 (+) 903 WP_080961990.1 SDR family oxidoreductase -
  QML77_RS00025 (CIRMBP1274_00005) - 4429..5640 (+) 1212 WP_016250476.1 MFS transporter -
  QML77_RS00030 - 5777..6112 (+) 336 Protein_5 AbrB family transcriptional regulator -
  QML77_RS00035 (CIRMBP1274_00007) yaaA 6367..6615 (+) 249 WP_016250474.1 S4 domain-containing protein YaaA -
  QML77_RS00040 (CIRMBP1274_00008) recF 6602..7741 (+) 1140 WP_016250473.1 DNA replication/repair protein RecF -
  QML77_RS00045 (CIRMBP1274_00009) gyrB 7768..9717 (+) 1950 WP_016250472.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  QML77_RS00050 (CIRMBP1274_00010) gyrA 9738..12242 (+) 2505 WP_281956901.1 DNA gyrase subunit A -
  QML77_RS00055 (CIRMBP1274_00011) - 12458..12829 (+) 372 WP_281956902.1 MmcQ/YjbR family DNA-binding protein -
  QML77_RS00060 (CIRMBP1274_00012) - 12826..13899 (+) 1074 WP_281956903.1 endonuclease/exonuclease/phosphatase family protein -
  QML77_RS00065 (CIRMBP1274_00013) - 14307..14621 (+) 315 WP_000420682.1 YdcP family protein -
  QML77_RS00070 (CIRMBP1274_00014) - 14637..15023 (+) 387 WP_000985015.1 YdcP family protein -
  QML77_RS00075 (CIRMBP1274_00015) - 15052..16437 (+) 1386 WP_000813488.1 FtsK/SpoIIIE domain-containing protein -
  QML77_RS00080 - 16440..16592 (+) 153 WP_000879507.1 hypothetical protein -
  QML77_RS00085 (CIRMBP1274_00016) mobT 16615..17820 (+) 1206 WP_281956904.1 MobT family relaxase -
  QML77_RS00090 (CIRMBP1274_00017) - 17863..18084 (+) 222 WP_001009056.1 hypothetical protein -
  QML77_RS00095 (CIRMBP1274_00018) - 18201..18698 (+) 498 WP_000342539.1 antirestriction protein ArdA -
  QML77_RS00100 - 18787..19179 (+) 393 WP_000723888.1 conjugal transfer protein -
  QML77_RS00105 (CIRMBP1274_00019) - 19163..20599 (+) 1437 Protein_20 ATP-binding protein -
  QML77_RS00110 (CIRMBP1274_00020) - 20664..21911 (-) 1248 WP_013923976.1 ISL3 family transposase -
  QML77_RS00115 - 22042..22131 (+) 90 Protein_22 IS5/IS1182 family transposase -
  QML77_RS00120 (CIRMBP1274_00021) - 22410..23327 (+) 918 WP_002324166.1 ABC transporter ATP-binding protein -
  QML77_RS00125 (CIRMBP1274_00022) - 23314..24930 (+) 1617 WP_013085964.1 ABC transporter permease -
  QML77_RS00130 (CIRMBP1274_00023) - 24927..25565 (+) 639 WP_003708736.1 TetR/AcrR family transcriptional regulator -
  QML77_RS00135 (CIRMBP1274_00024) - 25738..26985 (-) 1248 WP_013923976.1 ISL3 family transposase -
  QML77_RS00140 (CIRMBP1274_00025) - 27111..28130 (+) 1020 Protein_27 ATP-binding protein -
  QML77_RS00145 (CIRMBP1274_00026) - 28133..30310 (+) 2178 WP_000804748.1 membrane protein -
  QML77_RS00150 (CIRMBP1274_00027) - 30307..31308 (+) 1002 WP_000769868.1 bifunctional lysozyme/C40 family peptidase -
  QML77_RS00155 (CIRMBP1274_00028) - 31305..32240 (+) 936 WP_001224320.1 conjugal transfer protein -
  QML77_RS00160 - 32485..32601 (+) 117 WP_001791010.1 tetracycline resistance determinant leader peptide -
  QML77_RS00165 (CIRMBP1274_00029) tet(M) 32617..34536 (+) 1920 WP_047339182.1 tetracycline resistance ribosomal protection protein Tet(M) -
  QML77_RS00170 - 34655..34765 (+) 111 Protein_33 cysteine-rich KTR domain-containing protein -
  QML77_RS00175 (CIRMBP1274_00030) - 34838..34981 (+) 144 WP_158409719.1 hypothetical protein -
  QML77_RS00180 (CIRMBP1274_00031) tet(L) 35004..36419 (+) 1416 WP_047342058.1 tetracycline efflux MFS transporter Tet(L) -
  QML77_RS00185 - 36468..36851 (-) 384 WP_225354017.1 hypothetical protein -
  QML77_RS00190 (CIRMBP1274_00032) - 37075..37749 (+) 675 Protein_37 site-specific integrase -
  QML77_RS00195 (CIRMBP1274_00033) rpsF 38116..38415 (+) 300 WP_016250468.1 30S ribosomal protein S6 -
  QML77_RS00200 (CIRMBP1274_00034) ssb 38458..38976 (+) 519 WP_016250467.1 single-stranded DNA-binding protein Machinery gene
  QML77_RS00205 (CIRMBP1274_00035) rpsR 39006..39242 (+) 237 WP_016250466.1 30S ribosomal protein S18 -
  QML77_RS00210 (CIRMBP1274_00036) - 39433..39861 (+) 429 WP_204645766.1 NUDIX hydrolase -
  QML77_RS00215 (CIRMBP1274_00037) - 40246..41697 (+) 1452 WP_171315528.1 DHH family phosphoesterase -
  QML77_RS00220 (CIRMBP1274_00038) rplI 41710..42162 (+) 453 WP_016250461.1 50S ribosomal protein L9 -
  QML77_RS00225 (CIRMBP1274_00039) - 42234..42701 (+) 468 WP_281956905.1 NUDIX domain-containing protein -
  QML77_RS00230 (CIRMBP1274_00040) dnaB 42856..44226 (+) 1371 WP_281956906.1 replicative DNA helicase -
  QML77_RS00235 (CIRMBP1274_00041) - 44791..46953 (+) 2163 WP_281956907.1 PTS transporter subunit IIBC -
  QML77_RS00240 (CIRMBP1274_00042) - 47053..47850 (+) 798 WP_047334523.1 endonuclease/exonuclease/phosphatase family protein -
  QML77_RS00245 (CIRMBP1274_00043) - 48110..49402 (+) 1293 WP_047241769.1 adenylosuccinate synthase -
  QML77_RS00250 (CIRMBP1274_00044) - 49826..50695 (+) 870 WP_281956908.1 Rpn family recombination-promoting nuclease/putative transposase -
  QML77_RS00255 (CIRMBP1274_00045) - 50968..52170 (-) 1203 WP_281956909.1 MFS transporter -
  QML77_RS00260 (CIRMBP1274_00046) - 52480..54111 (-) 1632 WP_016250453.1 ATP-binding cassette domain-containing protein -
  QML77_RS00265 (CIRMBP1274_00047) - 54558..54890 (+) 333 WP_016250439.1 PTS sugar transporter subunit IIB -
  QML77_RS00270 (CIRMBP1274_00048) - 54910..55272 (+) 363 WP_016250438.1 PTS lactose/cellobiose transporter subunit IIA -
  QML77_RS00275 (CIRMBP1274_00049) - 55331..56419 (+) 1089 WP_281956910.1 MupG family TIM beta-alpha barrel fold protein -
  QML77_RS00280 (CIRMBP1274_00050) - 56689..58125 (+) 1437 WP_087403300.1 6-phospho-beta-glucosidase -
  QML77_RS00285 (CIRMBP1274_00051) - 58190..58684 (+) 495 WP_016250435.1 hypothetical protein -
  QML77_RS00290 (CIRMBP1274_00052) celB 58707..60053 (+) 1347 WP_016250434.1 PTS cellobiose transporter subunit IIC -
  QML77_RS00295 (CIRMBP1274_00053) - 60153..60866 (-) 714 WP_016250433.1 GntR family transcriptional regulator -
  QML77_RS00300 (CIRMBP1274_00054) - 61046..62527 (+) 1482 WP_168931964.1 family 1 glycosylhydrolase -
  QML77_RS00310 (CIRMBP1274_00057) - 64114..65361 (-) 1248 WP_281956911.1 glutamate-5-semialdehyde dehydrogenase -
  QML77_RS00315 (CIRMBP1274_00058) proB 65377..66180 (-) 804 WP_235426847.1 glutamate 5-kinase -
  QML77_RS12525 (CIRMBP1274_00059) - 66732..67004 (-) 273 WP_345741231.1 hypothetical protein -
  QML77_RS00325 (CIRMBP1274_00060) - 67215..67736 (+) 522 WP_026209954.1 hypothetical protein -
  QML77_RS00330 (CIRMBP1274_00061) radA 67749..69119 (+) 1371 WP_281956912.1 DNA repair protein RadA Machinery gene
  QML77_RS00335 (CIRMBP1274_00062) - 69319..70425 (+) 1107 WP_016250426.1 PIN/TRAM domain-containing protein -
  QML77_RS00340 (CIRMBP1274_00063) rfbC 70465..71022 (+) 558 WP_016250425.1 dTDP-4-dehydrorhamnose 3,5-epimerase -
  QML77_RS00345 (CIRMBP1274_00064) - 71273..71542 (+) 270 WP_243184525.1 hypothetical protein -
  QML77_RS00350 (CIRMBP1274_00065) - 71611..72087 (+) 477 WP_281956913.1 GNAT family N-acetyltransferase -
  QML77_RS00355 (CIRMBP1274_00066) gltX 72182..73639 (+) 1458 WP_016250422.1 glutamate--tRNA ligase -

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 19042.89 Da        Isoelectric Point: 4.7093

>NTDB_id=1155144 QML77_RS00200 WP_016250467.1 38458..38976(+) (ssb) [Enterococcus cecorum isolate CIRMBP-1274]
MINNVVLVGRLTRDPDLRYTSSGVAVATFSLAVNRNFTSQNGERETDFINCVIWRKPAETLANYARKGTLIGLTGRIQTR
NYENQQGQRVYVTEVVADNFQLLESKAVNDQRRQAAGNFDNNVSQPFNNNNNSFDQPASSQPFSGMPGFDRDASNTPLGG
SSIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=1155144 QML77_RS00200 WP_016250467.1 38458..38976(+) (ssb) [Enterococcus cecorum isolate CIRMBP-1274]
TTGATTAATAATGTTGTATTAGTAGGTAGATTAACAAGAGACCCTGATTTACGTTACACTTCTTCTGGTGTTGCGGTGGC
TACTTTTAGTTTAGCTGTGAACCGTAATTTTACCAGCCAAAATGGAGAAAGAGAAACGGACTTTATCAATTGTGTCATTT
GGCGTAAACCAGCTGAAACCTTAGCAAATTACGCTAGAAAAGGGACATTAATTGGTTTGACCGGACGTATTCAAACGAGA
AATTATGAAAACCAACAAGGTCAACGTGTATACGTAACTGAAGTGGTTGCCGATAATTTCCAATTATTAGAGTCTAAAGC
AGTCAACGATCAACGTCGTCAAGCTGCCGGAAACTTTGATAATAATGTCTCACAACCATTTAACAATAATAACAATAGCT
TTGATCAGCCAGCTTCATCTCAACCATTTAGTGGAATGCCTGGCTTTGACCGTGATGCAAGTAACACACCACTTGGCGGA
TCAAGCATTGACATTTCAGATGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2QMK6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

60.345

100

0.61

  ssbA Bacillus subtilis subsp. subtilis str. 168

53.409

100

0.547

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

61.628

0.366


Multiple sequence alignment