Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   LSAJ64_RS07440 Genome accession   NZ_LT960781
Coordinates   1442221..1442520 (-) Length   99 a.a.
NCBI ID   WP_099960317.1    Uniprot ID   -
Organism   Latilactobacillus sakei strain J64     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1437221..1447520
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LSAJ64_RS07405 (LSAJ64_1496) - 1437852..1438310 (-) 459 WP_099960310.1 laaL -
  LSAJ64_RS07410 (LSAJ64_1497) - 1438365..1439561 (-) 1197 WP_101377988.1 acetate/propionate family kinase -
  LSAJ64_RS07415 (LSAJ64_1498) - 1439583..1440593 (-) 1011 WP_099947695.1 class I SAM-dependent methyltransferase -
  LSAJ64_RS07420 (LSAJ64_1499) - 1440717..1441055 (-) 339 WP_035145011.1 hypothetical protein -
  LSAJ64_RS07425 (LSAJ64_1500) comGF 1441018..1441530 (-) 513 WP_101377989.1 competence type IV pilus minor pilin ComGF Machinery gene
  LSAJ64_RS07430 (LSAJ64_1501) comGE 1441505..1441810 (-) 306 WP_099960315.1 type II secretion system protein Machinery gene
  LSAJ64_RS07435 (LSAJ64_1502) comGD 1441797..1442249 (-) 453 WP_099960316.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  LSAJ64_RS07440 (LSAJ64_1503) comGC 1442221..1442520 (-) 300 WP_099960317.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  LSAJ64_RS07445 (LSAJ64_1504) comGB 1442517..1443524 (-) 1008 WP_101377990.1 type II secretion system F family protein Machinery gene
  LSAJ64_RS07450 (LSAJ64_1505) comGA 1443517..1444407 (-) 891 WP_016265378.1 competence type IV pilus ATPase ComGA Machinery gene
  LSAJ64_RS07455 (LSAJ64_1506) - 1444522..1445253 (-) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  LSAJ64_RS07460 (LSAJ64_1507) - 1445344..1445844 (-) 501 WP_099947696.1 VanZ family protein -
  LSAJ64_RS07465 (LSAJ64_1508) - 1445941..1446315 (+) 375 WP_011375004.1 hypothetical protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11123.05 Da        Isoelectric Point: 10.2031

>NTDB_id=1148403 LSAJ64_RS07440 WP_099960317.1 1442221..1442520(-) (comGC) [Latilactobacillus sakei strain J64]
MKKKRNAFTLIEMVIVLAIVALLILLISPNLVAQKQRAEKRTDQALVTTLQTQVELAADEQGHQIKSLDELTDKYISKDQ
LKHAKERGITIDSGTVKQK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=1148403 LSAJ64_RS07440 WP_099960317.1 1442221..1442520(-) (comGC) [Latilactobacillus sakei strain J64]
ATGAAGAAAAAAAGAAATGCTTTTACATTAATCGAAATGGTAATTGTTCTAGCTATTGTGGCGTTATTAATTTTATTAAT
CTCACCAAATTTGGTGGCTCAAAAACAGCGCGCGGAGAAGAGAACGGATCAAGCTTTGGTGACGACTTTACAAACACAAG
TTGAATTAGCTGCCGATGAACAAGGTCATCAAATTAAGAGTCTAGACGAATTAACGGATAAGTATATTTCAAAAGACCAG
TTAAAGCACGCAAAGGAGCGGGGGATTACAATTGATAGCGGTACGGTTAAGCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

87.879

100

0.879


Multiple sequence alignment