Detailed information NTG1144598

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: C7S03_RS09560
• Genome accession: NZ_LT592163
• Coordinates: 1633869..1634318 (-)
• Length: 149 a.a.
• NCBI ID: WP_002214937.1
• Uniprot ID: A0AA44U8B7
• Organism: Neisseria gonorrhoeae strain WHO_W
• Function: DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1627313..1641598	1633869..1634318	within	0

Gene organization within MGE regions

Location: 1627313..1641598

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
C7S03_RS09500 (WHOW_01793C)	-	1627313..1627591 (-)	279	WP_003691583.1	hypothetical protein	-
C7S03_RS09505 (WHOW_01794C)	-	1627598..1627816 (-)	219	WP_003691584.1	major capsid protein	-
C7S03_RS09510 (WHOW_01795C)	-	1627890..1628087 (-)	198	WP_003689600.1	hypothetical protein	-
C7S03_RS09515 (WHOW_01796C)	-	1628092..1628382 (-)	291	WP_012503914.1	hypothetical protein	-
C7S03_RS09520 (WHOW_01797C)	-	1628427..1629777 (-)	1351	Protein_1661	replication initiation factor domain-containing protein	-
C7S03_RS09530 (WHOW_01798C)	-	1629916..1630338 (-)	423	WP_003691751.1	very short patch repair endonuclease	-
C7S03_RS14085 (WHOW_01799C)	-	1630344..1630940 (-)	597	WP_012503916.1	TIGR02391 family protein	-
C7S03_RS14090 (WHOW_01800C)	-	1631130..1631987 (-)	858	WP_012503917.1	ATP-binding protein	-
C7S03_RS09540 (WHOW_01801C)	-	1632001..1632372 (-)	372	WP_012503918.1	DNA cytosine methyltransferase	-
C7S03_RS09545	-	1632369..1632977 (-)	609	WP_080229275.1	DNA cytosine methyltransferase	-
C7S03_RS09550 (WHOW_01802)	-	1633346..1633492 (+)	147	WP_003691757.1	hypothetical protein	-
C7S03_RS09560 (WHOW_01804C)	comP	1633869..1634318 (-)	450	WP_002214937.1	type IV pilin protein	Machinery gene
C7S03_RS09565 (WHOW_01805C)	comE	1634406..1634801 (-)	396	WP_003703428.1	helix-hairpin-helix domain-containing protein	Machinery gene
C7S03_RS14095	-	1634906..1635022 (-)	117	Protein_1670	competence protein ComE	-
C7S03_RS09600 (WHOW_01812C)	-	1640647..1641300 (-)	654	Protein_1671	TIGR01621 family pseudouridine synthase	-
C7S03_RS09605 (WHOW_01813C)	-	1641254..1641598 (-)	345	WP_003691787.1	HAD hydrolase family protein	-

Sequence

Protein

• Length: 149 a.a.
• Molecular weight: 16834.81 Da
• Isoelectric Point: 9.7951

>NTDB_id=1144598 C7S03_RS09560 WP_002214937.1 1633869..1634318(-) (comP) [Neisseria gonorrhoeae strain WHO_W]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK

Nucleotide

• Length: 450 bp

>NTDB_id=1144598 C7S03_RS09560 WP_002214937.1 1633869..1634318(-) (comP) [Neisseria gonorrhoeae strain WHO_W]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG

Domains

Predicted by InterproScan.

• Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS) (28-107)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Neisseria gonorrhoeae MS11	100	100	1
comP	Neisseria meningitidis 8013	99.329	100	0.993
comP	Neisseria subflava NJ9703	49.66	98.658	0.49