Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilL   Type   Machinery gene
Locus tag   E4V86_RS03075 Genome accession   NZ_LT591910
Coordinates   523499..523972 (+) Length   157 a.a.
NCBI ID   WP_172616897.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain WHO N     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 518959..562801 523499..523972 within 0


Gene organization within MGE regions


Location: 518959..562801
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E4V86_RS03050 (WHON_00553) dnaB 518959..520365 (+) 1407 WP_047951438.1 replicative DNA helicase -
  E4V86_RS03055 (WHON_00554) pilH 520673..521338 (+) 666 WP_047921008.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  E4V86_RS03060 (WHON_00555) pilI 521370..521978 (+) 609 WP_047920999.1 type IV pilus modification protein PilV Machinery gene
  E4V86_RS03065 (WHON_00556) pilJ 521975..522910 (+) 936 WP_047921001.1 PilW family protein Machinery gene
  E4V86_RS03070 (WHON_00557) pilK 522889..523497 (+) 609 WP_047921003.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  E4V86_RS03075 (WHON_00558) pilL 523499..523972 (+) 474 WP_172616897.1 PilX family type IV pilin Machinery gene
  E4V86_RS03080 (WHON_00559C) - 524042..524350 (-) 309 WP_010951048.1 AzlD family protein -
  E4V86_RS03085 - 524347..525056 (-) 710 Protein_529 AzlC family ABC transporter permease -
  E4V86_RS03090 (WHON_00561) dut 525222..525674 (+) 453 WP_047951389.1 dUTP diphosphatase -
  E4V86_RS03095 (WHON_00562) dapC 525746..526933 (+) 1188 WP_003690911.1 succinyldiaminopimelate transaminase -
  E4V86_RS03100 (WHON_00563) yaaA 527244..528023 (+) 780 WP_003706583.1 peroxide stress protein YaaA -
  E4V86_RS03115 (WHON_00566) - 528554..529747 (+) 1194 WP_010359935.1 tyrosine-type recombinase/integrase -
  E4V86_RS03125 (WHON_00567C) - 530103..530372 (-) 270 WP_003687928.1 hypothetical protein -
  E4V86_RS03130 (WHON_00568C) - 530567..531250 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  E4V86_RS14220 - 531531..531797 (-) 267 Protein_536 hypothetical protein -
  E4V86_RS03140 (WHON_00570C) - 531908..532123 (-) 216 WP_003691538.1 hypothetical protein -
  E4V86_RS03145 (WHON_00571C) - 532175..532666 (-) 492 WP_047926688.1 siphovirus Gp157 family protein -
  E4V86_RS03150 (WHON_00572C) - 532663..532845 (-) 183 WP_003691535.1 hypothetical protein -
  E4V86_RS03155 (WHON_00573C) - 532985..533671 (-) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  E4V86_RS03160 (WHON_00574C) - 533740..533901 (-) 162 WP_003702497.1 hypothetical protein -
  E4V86_RS03165 (WHON_00575C) - 533898..534176 (-) 279 WP_144894338.1 NGO1622 family putative holin -
  E4V86_RS03170 (WHON_00576C) - 534331..534663 (-) 333 WP_003705604.1 hypothetical protein -
  E4V86_RS03175 (WHON_00577C) - 534804..535079 (-) 276 WP_144894339.1 hypothetical protein -
  E4V86_RS03180 (WHON_00578C) - 535076..535552 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  E4V86_RS03185 (WHON_00579C) - 535585..535785 (-) 201 WP_003687954.1 hypothetical protein -
  E4V86_RS03190 (WHON_00580C) - 535983..536396 (-) 414 WP_003687963.1 hypothetical protein -
  E4V86_RS03195 (WHON_00581C) - 536393..536854 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  E4V86_RS03200 (WHON_00582C) - 536871..537308 (-) 438 WP_003687967.1 hypothetical protein -
  E4V86_RS03205 (WHON_00583C) - 537423..538139 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  E4V86_RS03210 (WHON_00584) - 538214..538444 (+) 231 WP_020997318.1 transcriptional regulator -
  E4V86_RS03215 (WHON_00585) - 538524..538679 (+) 156 WP_047923772.1 hypothetical protein -
  E4V86_RS03220 (WHON_00586C) - 538656..538844 (-) 189 WP_003698903.1 hypothetical protein -
  E4V86_RS03225 (WHON_00587) - 539018..539245 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  E4V86_RS14225 (WHON_00589) - 539363..540427 (+) 1065 WP_003693470.1 hypothetical protein -
  E4V86_RS03235 (WHON_00590) - 540424..541785 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  E4V86_RS03240 (WHON_00591) - 541802..542032 (+) 231 WP_050154378.1 hypothetical protein -
  E4V86_RS03245 (WHON_00592) - 542124..542618 (+) 495 WP_144894340.1 DUF3310 domain-containing protein -
  E4V86_RS03250 (WHON_00593) - 542795..542944 (+) 150 WP_003689110.1 hypothetical protein -
  E4V86_RS13630 (WHON_00594) - 542972..543253 (+) 282 WP_003689109.1 hypothetical protein -
  E4V86_RS03255 (WHON_00595) - 543244..543681 (+) 438 WP_047918627.1 RusA family crossover junction endodeoxyribonuclease -
  E4V86_RS03260 (WHON_00596) - 543674..543979 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  E4V86_RS03265 (WHON_00597) - 543976..544359 (+) 384 WP_003690918.1 recombination protein NinB -
  E4V86_RS03270 (WHON_00598) - 544350..544868 (+) 519 WP_003687984.1 HNH endonuclease -
  E4V86_RS03275 (WHON_00599) - 544933..545355 (+) 423 WP_003690919.1 hypothetical protein -
  E4V86_RS13635 (WHON_00600) - 545355..545894 (+) 540 WP_003690920.1 hypothetical protein -
  E4V86_RS03290 (WHON_00601) - 545875..547149 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  E4V86_RS03295 (WHON_00602) - 547134..549401 (+) 2268 WP_225577699.1 hypothetical protein -
  E4V86_RS03300 (WHON_00603) - 549638..550834 (+) 1197 WP_003690925.1 hypothetical protein -
  E4V86_RS03305 (WHON_00604) - 550831..552045 (+) 1215 WP_047954539.1 hypothetical protein -
  E4V86_RS14400 (WHON_00605) - 552248..558157 (+) 5910 WP_134472138.1 PLxRFG domain-containing protein -
  E4V86_RS03320 (WHON_00607) - 558783..560078 (+) 1296 WP_003690933.1 DUF4043 family protein -
  E4V86_RS03325 (WHON_00608) - 560133..560606 (+) 474 WP_003690936.1 hypothetical protein -
  E4V86_RS03330 (WHON_00609) - 560612..561097 (+) 486 WP_003687997.1 hypothetical protein -
  E4V86_RS03335 - 561094..561369 (+) 276 WP_010358526.1 hypothetical protein -
  E4V86_RS03340 (WHON_00610) - 561360..561767 (+) 408 WP_010358525.1 hypothetical protein -
  E4V86_RS03345 (WHON_00611) - 561770..561919 (+) 150 WP_003706419.1 hypothetical protein -
  E4V86_RS03350 (WHON_00612C) - 561956..562801 (-) 846 WP_134472134.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17530.30 Da        Isoelectric Point: 9.1635

>NTDB_id=1144207 E4V86_RS03075 WP_172616897.1 523499..523972(+) (pilL) [Neisseria gonorrhoeae strain WHO N]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVLGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQAYSDTLSADSGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=1144207 E4V86_RS03075 WP_172616897.1 523499..523972(+) (pilL) [Neisseria gonorrhoeae strain WHO N]
ATGGAGCAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACAATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGCCTATTCGGACACCTTGTCCGCAGATAGCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

94.268

100

0.943

  pilX Neisseria meningitidis 8013

84.076

100

0.841


Multiple sequence alignment