Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilI   Type   Machinery gene
Locus tag   C7S00_RS07700 Genome accession   NZ_LT591901
Coordinates   1320841..1321449 (-) Length   202 a.a.
NCBI ID   WP_047920999.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain WHO L     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1280218..1329253 1320841..1321449 within 0


Gene organization within MGE regions


Location: 1280218..1329253
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7S00_RS07410 (WHOL_01385) - 1280218..1281063 (+) 846 WP_106215960.1 Bro-N domain-containing protein -
  C7S00_RS07415 (WHOL_01386C) - 1281100..1281249 (-) 150 WP_003706419.1 hypothetical protein -
  C7S00_RS07420 (WHOL_01387C) - 1281252..1281659 (-) 408 WP_010358525.1 hypothetical protein -
  C7S00_RS07425 - 1281650..1281925 (-) 276 WP_010358526.1 hypothetical protein -
  C7S00_RS07430 (WHOL_01388C) - 1281922..1282407 (-) 486 WP_003687997.1 hypothetical protein -
  C7S00_RS07435 (WHOL_01389C) - 1282413..1282886 (-) 474 WP_003687996.1 hypothetical protein -
  C7S00_RS07440 (WHOL_01390C) - 1282941..1284236 (-) 1296 WP_003695011.1 DUF4043 family protein -
  C7S00_RS14175 (WHOL_01392C) - 1284862..1290795 (-) 5934 WP_025456003.1 PLxRFG domain-containing protein -
  C7S00_RS07455 (WHOL_01393C) - 1290998..1292212 (-) 1215 WP_172616921.1 hypothetical protein -
  C7S00_RS07460 (WHOL_01394C) - 1292209..1293405 (-) 1197 WP_003693452.1 hypothetical protein -
  C7S00_RS07465 (WHOL_01395C) - 1293642..1295909 (-) 2268 WP_229687112.1 hypothetical protein -
  C7S00_RS07470 (WHOL_01396C) - 1295894..1297168 (-) 1275 WP_047919159.1 PBSX family phage terminase large subunit -
  C7S00_RS13810 (WHOL_01397C) - 1297149..1297688 (-) 540 WP_003690920.1 hypothetical protein -
  C7S00_RS07485 (WHOL_01398C) - 1297688..1298110 (-) 423 WP_003690919.1 hypothetical protein -
  C7S00_RS07490 (WHOL_01399C) - 1298175..1298693 (-) 519 WP_003687984.1 HNH endonuclease -
  C7S00_RS07495 (WHOL_01400C) - 1298684..1299067 (-) 384 WP_003690918.1 recombination protein NinB -
  C7S00_RS07500 (WHOL_01401C) - 1299064..1299366 (-) 303 WP_003704256.1 DUF1364 domain-containing protein -
  C7S00_RS07505 (WHOL_01402C) - 1299363..1299737 (-) 375 WP_229691906.1 RusA family crossover junction endodeoxyribonuclease -
  C7S00_RS13815 (WHOL_01403C) - 1299728..1300009 (-) 282 WP_003689109.1 hypothetical protein -
  C7S00_RS07510 (WHOL_01404C) - 1300038..1300187 (-) 150 WP_003689110.1 hypothetical protein -
  C7S00_RS07515 (WHOL_01405C) - 1300364..1300858 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  C7S00_RS07525 (WHOL_01407C) - 1301195..1302556 (-) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  C7S00_RS07530 (WHOL_01408C) - 1302553..1303617 (-) 1065 WP_003689134.1 hypothetical protein -
  C7S00_RS07535 (WHOL_01410C) - 1303735..1303962 (-) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  C7S00_RS07540 (WHOL_01411) - 1304135..1304323 (+) 189 WP_003691445.1 hypothetical protein -
  C7S00_RS07545 (WHOL_01412C) - 1304300..1304455 (-) 156 WP_003691446.1 hypothetical protein -
  C7S00_RS07550 - 1304565..1304765 (-) 201 WP_229687133.1 transcriptional regulator -
  C7S00_RS07555 (WHOL_01413) - 1304894..1305556 (+) 663 WP_012503489.1 LexA family transcriptional regulator -
  C7S00_RS07560 (WHOL_01414) - 1305669..1306106 (+) 438 WP_003687967.1 hypothetical protein -
  C7S00_RS07565 (WHOL_01415) - 1306123..1306584 (+) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  C7S00_RS07570 (WHOL_01416) - 1306581..1306994 (+) 414 WP_003687963.1 hypothetical protein -
  C7S00_RS07575 (WHOL_01417) - 1307192..1307392 (+) 201 WP_047919800.1 hypothetical protein -
  C7S00_RS07580 (WHOL_01418) - 1307425..1307901 (+) 477 WP_002255718.1 DUF6948 domain-containing protein -
  C7S00_RS07585 (WHOL_01419) - 1307898..1308167 (+) 270 WP_144961298.1 hypothetical protein -
  C7S00_RS07590 (WHOL_01420) - 1308309..1308641 (+) 333 WP_047923919.1 hypothetical protein -
  C7S00_RS07595 (WHOL_01421) - 1308794..1309072 (+) 279 WP_047921031.1 NGO1622 family putative holin -
  C7S00_RS07600 (WHOL_01422) - 1309069..1309230 (+) 162 WP_003693867.1 hypothetical protein -
  C7S00_RS07605 (WHOL_01423) - 1309299..1309985 (+) 687 WP_047921032.1 phage replication initiation protein, NGO0469 family -
  C7S00_RS07610 (WHOL_01424) - 1310125..1310307 (+) 183 WP_003691535.1 hypothetical protein -
  C7S00_RS07615 (WHOL_01425) - 1310304..1310795 (+) 492 WP_003691537.1 siphovirus Gp157 family protein -
  C7S00_RS07620 (WHOL_01426) - 1310847..1311062 (+) 216 WP_003691538.1 hypothetical protein -
  C7S00_RS14180 - 1311173..1311439 (+) 267 Protein_1315 hypothetical protein -
  C7S00_RS07630 (WHOL_01428) - 1311720..1312403 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  C7S00_RS07635 (WHOL_01429) - 1312598..1312867 (+) 270 WP_003687928.1 hypothetical protein -
  C7S00_RS07640 (WHOL_01430) - 1312929..1313138 (+) 210 WP_047919504.1 lactate dehydrogenase -
  C7S00_RS07645 (WHOL_01431C) - 1313225..1314419 (-) 1195 Protein_1319 tyrosine-type recombinase/integrase -
  C7S00_RS07660 (WHOL_01434C) yaaA 1314949..1315728 (-) 780 WP_003687925.1 peroxide stress protein YaaA -
  C7S00_RS07665 (WHOL_01435C) dapC 1315884..1317071 (-) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  C7S00_RS07670 (WHOL_01436C) dut 1317143..1317595 (-) 453 WP_003702446.1 dUTP diphosphatase -
  C7S00_RS07675 - 1317761..1318472 (+) 712 Protein_1323 AzlC family ABC transporter permease -
  C7S00_RS07680 (WHOL_01439) - 1318469..1318777 (+) 309 WP_047921007.1 AzlD family protein -
  C7S00_RS07685 (WHOL_01440C) pilL 1318847..1319320 (-) 474 WP_172616930.1 PilX family type IV pilin Machinery gene
  C7S00_RS07690 (WHOL_01441C) pilK 1319322..1319930 (-) 609 WP_047921003.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  C7S00_RS07695 (WHOL_01442C) pilJ 1319909..1320844 (-) 936 WP_047921001.1 PilW family protein Machinery gene
  C7S00_RS07700 (WHOL_01443C) pilI 1320841..1321449 (-) 609 WP_047920999.1 type IV pilus modification protein PilV Machinery gene
  C7S00_RS07705 (WHOL_01444C) pilH 1321481..1322146 (-) 666 WP_047921008.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  C7S00_RS07710 (WHOL_01445C) dnaB 1322454..1323860 (-) 1407 WP_047920816.1 replicative DNA helicase -
  C7S00_RS07720 (WHOL_01446) - 1324023..1324604 (+) 582 WP_003698180.1 superoxide dismutase -
  C7S00_RS07730 (WHOL_01447C) - 1324834..1325343 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  C7S00_RS07735 (WHOL_01448C) - 1325670..1326002 (-) 333 WP_003687908.1 hypothetical protein -
  C7S00_RS07740 (WHOL_01449) cysT 1326188..1327026 (+) 839 Protein_1334 sulfate ABC transporter permease subunit CysT -
  C7S00_RS07745 (WHOL_01450) cysW 1327215..1328036 (+) 822 WP_003701049.1 sulfate ABC transporter permease subunit CysW -
  C7S00_RS07750 - 1328020..1328154 (+) 135 Protein_1336 IS5/IS1182 family transposase -
  C7S00_RS07755 (WHOL_01451) - 1328177..1329253 (+) 1077 WP_003701047.1 sulfate/molybdate ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 202 a.a.        Molecular weight: 22092.95 Da        Isoelectric Point: 4.9915

>NTDB_id=1144072 C7S00_RS07700 WP_047920999.1 1320841..1321449(-) (pilI) [Neisseria gonorrhoeae strain WHO L]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYTKSYPSTSSNGDFKLDNLISKRDLAKTQLDRFGYELKNALPDAVAIHYTVCKDSSGDAPTLSGNTFSSNCDNKANG
DTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGRE

Nucleotide


Download         Length: 609 bp        

>NTDB_id=1144072 C7S00_RS07700 WP_047920999.1 1320841..1321449(-) (pilI) [Neisseria gonorrhoeae strain WHO L]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGTTGTCCGTACAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGAAGTCGTACCCCTCCACTTCCTCTAACGGCGATTTCAAGCTTGATAATTTGATAAGTAAGAGGGA
TTTGGCAAAGACCCAGTTGGACAGGTTCGGTTATGAATTGAAAAATGCCTTGCCGGATGCGGTAGCTATTCATTACACCG
TCTGCAAGGATTCGTCGGGTGACGCGCCGACATTGTCCGGCAATACTTTTTCTTCAAATTGCGACAATAAGGCAAACGGG
GATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAGGTGAGCGG
CGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilI Neisseria gonorrhoeae MS11

93.069

100

0.931
  pilV Neisseria gonorrhoeae MS11

93.069

100

0.931
  pilV Neisseria meningitidis 8013

86.408

100

0.881

Multiple sequence alignment