Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HPOKI828_RS07530 Genome accession   NZ_CP006826
Coordinates   1563656..1563781 (-) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori oki828     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1558656..1568781
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPOKI828_RS07510 (HPOKI828_07830) - 1559343..1560755 (-) 1413 WP_025223376.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPOKI828_RS07515 (HPOKI828_07835) comB10 1560825..1561961 (-) 1137 WP_025223377.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPOKI828_RS07520 (HPOKI828_07840) comB9 1561954..1562916 (-) 963 WP_025223378.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPOKI828_RS07525 (HPOKI828_07845) comB8 1562916..1563659 (-) 744 WP_025223379.1 type IV secretion system protein Machinery gene
  HPOKI828_RS07530 (HPOKI828_07850) comB7 1563656..1563781 (-) 126 WP_001217867.1 hypothetical protein Machinery gene
  HPOKI828_RS07535 (HPOKI828_07855) comB6 1563797..1564852 (-) 1056 WP_025223380.1 P-type conjugative transfer protein TrbL Machinery gene
  HPOKI828_RS07540 (HPOKI828_07860) - 1564860..1565855 (-) 996 WP_025223381.1 PDZ domain-containing protein -
  HPOKI828_RS07545 (HPOKI828_07865) - 1565855..1566148 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HPOKI828_RS07550 (HPOKI828_07870) panD 1566159..1566509 (-) 351 WP_025223382.1 aspartate 1-decarboxylase -
  HPOKI828_RS07555 (HPOKI828_07875) - 1566499..1568721 (-) 2223 WP_025223383.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=114261 HPOKI828_RS07530 WP_001217867.1 1563656..1563781(-) (comB7) [Helicobacter pylori oki828]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=114261 HPOKI828_RS07530 WP_001217867.1 1563656..1563781(-) (comB7) [Helicobacter pylori oki828]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829

Multiple sequence alignment