Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HPOKI154_RS07555 Genome accession   NZ_CP006823
Coordinates   1563146..1563271 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori oki154     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1558146..1568271
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPOKI154_RS07535 (HPOKI154_07825) - 1558833..1560245 (-) 1413 WP_025367111.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPOKI154_RS07540 (HPOKI154_07830) comB10 1560315..1561451 (-) 1137 WP_025367112.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPOKI154_RS07545 (HPOKI154_07835) comB9 1561444..1562406 (-) 963 WP_025314238.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPOKI154_RS07550 (HPOKI154_07840) comB8 1562406..1563149 (-) 744 WP_025367113.1 type IV secretion system protein Machinery gene
  HPOKI154_RS07555 (HPOKI154_07845) comB7 1563146..1563271 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  HPOKI154_RS07560 (HPOKI154_07850) comB6 1563287..1564342 (-) 1056 WP_025367114.1 P-type conjugative transfer protein TrbL Machinery gene
  HPOKI154_RS07565 (HPOKI154_07855) - 1564350..1565345 (-) 996 WP_025367115.1 PDZ domain-containing protein -
  HPOKI154_RS07570 (HPOKI154_07860) - 1565345..1565638 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  HPOKI154_RS07575 (HPOKI154_07865) panD 1565649..1565999 (-) 351 WP_025367116.1 aspartate 1-decarboxylase -
  HPOKI154_RS07580 (HPOKI154_07870) - 1565989..1568211 (-) 2223 WP_025367117.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=114195 HPOKI154_RS07555 WP_001217874.1 1563146..1563271(-) (comB7) [Helicobacter pylori oki154]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=114195 HPOKI154_RS07555 WP_001217874.1 1563146..1563271(-) (comB7) [Helicobacter pylori oki154]
ATGAGAATTTTTTTTGTCATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment