Detailed information NTG1141890

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: DQK98_RS02670
• Genome accession: NZ_LS483449
• Coordinates: 506649..506798 (+)
• Length: 49 a.a.
• NCBI ID: WP_001809846.1
• Uniprot ID: Q00MV6
• Organism: Streptococcus pneumoniae strain 4041STDY6836170
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Genomic Context

Location: 501649..511798

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DQK98_RS02640	blpC	501909..502064 (-)	156	WP_044791640.1	quorum-sensing system pheromone BlpC	-
DQK98_RS02645	-	502121..503482 (-)	1362	Protein_504	bacteriocin secretion accessory protein	-
DQK98_RS02650	comA/nlmT	503493..505169 (-)	1677	WP_196299874.1	peptide cleavage/export ABC transporter	Regulator
DQK98_RS12195	comA/nlmT	505063..505650 (-)	588	WP_000205166.1	cysteine peptidase family C39 domain-containing protein	Regulator
DQK98_RS02655	blpM	505932..506186 (+)	255	WP_001093256.1	two-peptide bacteriocin subunit BlpM	-
DQK98_RS02660	blpN	506202..506405 (+)	204	WP_001099490.1	two-peptide bacteriocin subunit BlpN	-
DQK98_RS02670	cipB	506649..506798 (+)	150	WP_001809846.1	bacteriocin-like peptide BlpO	Regulator
DQK98_RS02675	-	506902..507021 (+)	120	WP_000346296.1	PncF family bacteriocin immunity protein	-
DQK98_RS02680	-	507319..507483 (+)	165	WP_000727117.1	hypothetical protein	-
DQK98_RS02685	-	507545..507883 (+)	339	WP_088804618.1	immunity protein	-
DQK98_RS02695	-	508512..508895 (+)	384	WP_000877381.1	hypothetical protein	-
DQK98_RS02700	-	508947..509636 (+)	690	WP_000760520.1	CPBP family intramembrane glutamic endopeptidase	-
DQK98_RS02705	blpZ	509678..509926 (+)	249	WP_000276501.1	immunity protein BlpZ	-
DQK98_RS02710	-	509956..510567 (+)	612	WP_000394036.1	CPBP family intramembrane glutamic endopeptidase	-
DQK98_RS02715	ccrZ	510728..511522 (+)	795	WP_000363002.1	cell cycle regulator CcrZ	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5149.92 Da
• Isoelectric Point: 4.0439

>NTDB_id=1141890 DQK98_RS02670 WP_001809846.1 506649..506798(+) (cipB) [Streptococcus pneumoniae strain 4041STDY6836170]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=1141890 DQK98_RS02670 WP_001809846.1 506649..506798(+) (cipB) [Streptococcus pneumoniae strain 4041STDY6836170]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

3D structure

• AlphaFold DB: Q00MV6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	53.061	100	0.531