Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   H1W90_RS03495 Genome accession   NZ_LR822033
Coordinates   667565..668305 (+) Length   246 a.a.
NCBI ID   WP_096811959.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_1048     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 661898..725240 667565..668305 within 0


Gene organization within MGE regions


Location: 661898..725240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1W90_RS03465 (STHERMO_0745) - 662174..663589 (+) 1416 WP_180481264.1 HEPN domain-containing protein -
  H1W90_RS03470 (STHERMO_0746) - 664095..664457 (+) 363 WP_039671040.1 SAG1252 family conjugative relaxosome accessory protein -
  H1W90_RS03475 (STHERMO_0747) - 664460..664825 (+) 366 WP_039671039.1 plasmid mobilization protein -
  H1W90_RS03480 (STHERMO_0748) - 664812..666695 (+) 1884 WP_180481265.1 SAG1250 family conjugative relaxase -
  H1W90_RS09910 (STHERMO_0749) - 666628..667023 (-) 396 WP_232085807.1 hypothetical protein -
  H1W90_RS03490 (STHERMO_0750) - 667222..667563 (+) 342 WP_024404826.1 LytR/AlgR family response regulator transcription factor -
  H1W90_RS03495 (STHERMO_0751) comE/blpR 667565..668305 (+) 741 WP_096811959.1 response regulator transcription factor Regulator
  H1W90_RS03500 (STHERMO_0752) - 668316..669656 (+) 1341 WP_039671036.1 sensor histidine kinase -
  H1W90_RS03505 (STHERMO_0753) - 669704..669859 (-) 156 WP_096811960.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  H1W90_RS03510 (STHERMO_0754) - 669958..671319 (-) 1362 WP_173940475.1 bacteriocin secretion accessory protein -
  H1W90_RS03515 (STHERMO_0755) comA/nlmT 671331..673484 (-) 2154 WP_039671034.1 peptide cleavage/export ABC transporter Regulator
  H1W90_RS03520 (STHERMO_0756) - 673781..674035 (+) 255 WP_039671033.1 Blp family class II bacteriocin -
  H1W90_RS03525 (STHERMO_0757) - 674050..674253 (+) 204 WP_039671032.1 Blp family class II bacteriocin -
  H1W90_RS03530 (STHERMO_0758) - 674767..675045 (-) 279 Protein_657 transposase -
  H1W90_RS03535 - 675253..676357 (-) 1105 Protein_658 IS3 family transposase -
  H1W90_RS03540 (STHERMO_0761) - 677048..677254 (+) 207 WP_065973044.1 Blp family class II bacteriocin -
  H1W90_RS03545 (STHERMO_0762) - 677295..677483 (+) 189 WP_039671028.1 hypothetical protein -
  H1W90_RS03550 (STHERMO_0764) - 678193..678450 (+) 258 WP_039671027.1 Blp family class II bacteriocin -
  H1W90_RS03555 (STHERMO_0765) - 678467..678661 (+) 195 WP_039671026.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  H1W90_RS03560 - 679264..680615 (+) 1352 WP_096811962.1 IS3 family transposase -
  H1W90_RS03565 (STHERMO_0769) - 681036..682067 (+) 1032 WP_065973046.1 thioredoxin fold domain-containing protein -
  H1W90_RS03570 (STHERMO_0770) - 682071..682766 (+) 696 WP_065973047.1 CPBP family intramembrane glutamic endopeptidase -
  H1W90_RS03575 (STHERMO_0771) - 682796..682948 (+) 153 WP_155758745.1 hypothetical protein -
  H1W90_RS03580 (STHERMO_0772) - 683134..683529 (+) 396 WP_065973048.1 hypothetical protein -
  H1W90_RS03585 (STHERMO_0774) - 684036..685829 (+) 1794 WP_176243450.1 recombinase family protein -
  H1W90_RS03590 (STHERMO_0775) - 686034..686864 (+) 831 WP_180481266.1 GIY-YIG nuclease family protein -
  H1W90_RS03595 (STHERMO_0776) - 687032..687253 (+) 222 WP_022096985.1 helix-turn-helix domain-containing protein -
  H1W90_RS03600 (STHERMO_0777) - 687250..687711 (+) 462 WP_224103660.1 DNA adenine methylase -
  H1W90_RS03605 (STHERMO_0778) - 687878..688033 (-) 156 WP_180481267.1 hypothetical protein -
  H1W90_RS03610 - 688049..688210 (+) 162 WP_180481268.1 hypothetical protein -
  H1W90_RS03615 (STHERMO_0780) - 688306..688920 (+) 615 WP_176243453.1 DUF2140 domain-containing protein -
  H1W90_RS03620 (STHERMO_0781) cas9 689174..692542 (+) 3369 WP_173940471.1 type II CRISPR RNA-guided endonuclease Cas9 -
  H1W90_RS03625 (STHERMO_0782) cas1 692719..693630 (+) 912 WP_011227029.1 type II CRISPR-associated endonuclease Cas1 -
  H1W90_RS03630 (STHERMO_0783) cas2 693632..693955 (+) 324 WP_002946754.1 CRISPR-associated endonuclease Cas2 -
  H1W90_RS03635 (STHERMO_0784) csn2-St 693952..695004 (+) 1053 WP_173940470.1 CRISPR-associated protein Csn2-St -
  H1W90_RS03640 (STHERMO_0787) - 696994..697809 (-) 816 WP_180481269.1 TIGR03943 family putative permease subunit -
  H1W90_RS03645 (STHERMO_0788) - 697809..698711 (-) 903 WP_173940468.1 permease -
  H1W90_RS10290 (STHERMO_0789) - 698717..698848 (-) 132 WP_002952698.1 SPJ_0845 family protein -
  H1W90_RS03650 (STHERMO_0790) - 699075..701207 (+) 2133 WP_173940467.1 Tex family protein -
  H1W90_RS03655 (STHERMO_0791) - 701194..701634 (+) 441 WP_002946099.1 SprT family protein -
  H1W90_RS03660 (STHERMO_0792) - 701701..701964 (+) 264 WP_011225732.1 PspC domain-containing protein -
  H1W90_RS03665 (STHERMO_0793) hprK 702093..703022 (+) 930 WP_173940466.1 HPr(Ser) kinase/phosphatase -
  H1W90_RS03670 (STHERMO_0794) lgt 703022..703813 (+) 792 WP_011225734.1 prolipoprotein diacylglyceryl transferase -
  H1W90_RS03675 (STHERMO_0795) - 703936..704334 (+) 399 WP_022096784.1 DUF948 domain-containing protein -
  H1W90_RS03680 (STHERMO_0796) - 704347..704787 (+) 441 WP_180473476.1 YtxH domain-containing protein -
  H1W90_RS03685 (STHERMO_0797) - 704808..705104 (-) 297 WP_002945999.1 DUF3270 domain-containing protein -
  H1W90_RS03690 (STHERMO_0798) - 705337..706266 (+) 930 WP_014608144.1 peptidase U32 family protein -
  H1W90_RS03695 (STHERMO_0799) - 706363..707649 (+) 1287 WP_002945995.1 peptidase U32 family protein -
  H1W90_RS03700 - 707649..707968 (+) 320 Protein_692 CHY zinc finger protein -
  H1W90_RS03705 (STHERMO_0800) - 708019..708558 (-) 540 WP_180481270.1 biotin transporter BioY -
  H1W90_RS03710 (STHERMO_0801) - 708653..708937 (-) 285 WP_176243464.1 hypothetical protein -
  H1W90_RS03715 (STHERMO_0802) - 709063..709275 (+) 213 WP_002886106.1 YdbC family protein -
  H1W90_RS03720 (STHERMO_0803) - 709310..710644 (-) 1335 WP_179970460.1 Nramp family divalent metal transporter -
  H1W90_RS03725 (STHERMO_0804) - 710840..711148 (+) 309 WP_176243224.1 hypothetical protein -
  H1W90_RS03730 (STHERMO_0805) - 711251..711640 (+) 390 WP_041826993.1 (deoxy)nucleoside triphosphate pyrophosphohydrolase -
  H1W90_RS03735 (STHERMO_0807) - 711663..714547 (-) 2885 Protein_699 DUF3427 domain-containing protein -
  H1W90_RS03740 (STHERMO_0810) lysS 715185..716675 (-) 1491 WP_041828189.1 lysine--tRNA ligase -
  H1W90_RS03745 (STHERMO_0811) - 716903..718213 (+) 1311 Protein_701 LysM peptidoglycan-binding domain-containing protein -
  H1W90_RS03750 (STHERMO_0813) - 718227..718706 (+) 480 Protein_702 hypothetical protein -
  H1W90_RS03755 (STHERMO_0814) - 719032..719934 (+) 903 WP_011225749.1 HAD family hydrolase -
  H1W90_RS03760 (STHERMO_0817) - 720359..720997 (-) 639 WP_173940457.1 histidine phosphatase family protein -
  H1W90_RS03765 (STHERMO_0818) - 721000..721473 (-) 474 WP_002950328.1 aminoacyl-tRNA deacylase -
  H1W90_RS03770 (STHERMO_0819) - 721588..722535 (-) 948 WP_014608156.1 glycoside hydrolase family 25 protein -
  H1W90_RS03775 (STHERMO_0820) - 722727..723116 (-) 390 WP_002948103.1 hypothetical protein -
  H1W90_RS03780 (STHERMO_0821) - 723372..723998 (-) 627 WP_173940456.1 Pr6Pr family membrane protein -

Sequence

Protein


Download         Length: 246 a.a.        Molecular weight: 28894.15 Da        Isoelectric Point: 7.2201

>NTDB_id=1131639 H1W90_RS03495 WP_096811959.1 667565..668305(+) (comE/blpR) [Streptococcus thermophilus isolate STH_CIRM_1048]
MNIFVMEDDFMQQARIEKIITKLLEKHNIVPKKFEISGKPHQLLQAIEEKGVHQLFFLDIEIKEDELKGLQVAKQIREID
PYASIVFVTTHSEFMPLSFRYQVSALDYIDKELGVTEFESRIEAALLHTHNKDNSAVSDDSFYFKSKYAQVQYPFNEVYY
IETSPRPHRVILYTKTDRMEFTASLSDILKQDKRLVQCHRSFAINPRNVVKVDRNEKQIYFPNGATCFISRQKLESTLAV
IDRLHR

Nucleotide


Download         Length: 741 bp        

>NTDB_id=1131639 H1W90_RS03495 WP_096811959.1 667565..668305(+) (comE/blpR) [Streptococcus thermophilus isolate STH_CIRM_1048]
ATGAATATCTTTGTAATGGAAGATGATTTTATGCAACAAGCGAGAATTGAGAAGATTATTACTAAGCTGTTAGAAAAGCA
CAACATCGTTCCGAAAAAATTTGAAATTTCAGGAAAACCTCATCAGCTACTTCAAGCAATAGAAGAAAAAGGAGTACATC
AGCTCTTCTTTTTAGATATTGAGATTAAGGAAGACGAACTAAAAGGACTTCAAGTCGCTAAACAAATTAGAGAGATTGAC
CCTTATGCTAGTATTGTTTTTGTGACAACACACTCCGAGTTTATGCCCTTATCTTTCAGGTACCAGGTATCTGCCTTGGA
CTATATTGACAAAGAGCTTGGAGTTACCGAATTTGAATCGCGAATAGAAGCAGCTTTACTTCATACTCACAATAAGGACA
ATAGCGCCGTATCGGATGATTCATTCTATTTTAAGTCCAAATATGCTCAAGTACAATACCCATTCAATGAAGTGTACTAC
ATCGAGACTTCTCCCCGCCCTCATCGTGTTATCCTTTATACCAAGACAGACCGAATGGAGTTCACAGCAAGTTTGTCAGA
CATTTTGAAACAAGATAAACGACTTGTACAATGTCATCGTTCGTTTGCAATCAATCCGAGGAATGTTGTTAAAGTGGATA
GAAATGAAAAACAGATCTACTTTCCTAATGGAGCCACCTGTTTTATTTCAAGGCAAAAGCTAGAATCAACTTTAGCTGTT
ATTGATAGACTGCATAGATAA

Domains

Predicted by InterproScan.

Response regulator receiver domain (Response_reg)

(3-122)

LytTr DNA-binding domain (LytTR)

(151-235)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

53.719

98.374

0.528
  comE/comE1 Streptococcus equinus JB1

41.423

97.154

0.402
  comE/comE2 Streptococcus equinus JB1

36.475

99.187

0.362

Multiple sequence alignment