Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAMY6639_RS02955 | Genome accession | NZ_CP006058 |
| Coordinates | 666258..666431 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens UMAF6639 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 661258..671431
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAMY6639_RS02940 (BAMY6639_03105) | gcvT | 662071..663171 (-) | 1101 | WP_061860709.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAMY6639_RS02945 (BAMY6639_03110) | - | 663595..665265 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| BAMY6639_RS02950 (BAMY6639_03115) | - | 665287..666081 (+) | 795 | WP_061860710.1 | YqhG family protein | - |
| BAMY6639_RS02955 (BAMY6639_03120) | sinI | 666258..666431 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BAMY6639_RS02960 (BAMY6639_03125) | sinR | 666465..666800 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAMY6639_RS02965 (BAMY6639_03130) | tasA | 666848..667633 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BAMY6639_RS02970 (BAMY6639_03135) | sipW | 667698..668282 (-) | 585 | WP_061860711.1 | signal peptidase I SipW | - |
| BAMY6639_RS02975 (BAMY6639_03140) | tapA | 668254..668925 (-) | 672 | WP_060674605.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAMY6639_RS02980 (BAMY6639_03145) | - | 669184..669513 (+) | 330 | WP_060674607.1 | DUF3889 domain-containing protein | - |
| BAMY6639_RS02985 (BAMY6639_03150) | - | 669553..669732 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BAMY6639_RS02990 (BAMY6639_03155) | comGG | 669789..670166 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAMY6639_RS02995 (BAMY6639_03160) | comGF | 670167..670562 (-) | 396 | WP_060674609.1 | competence type IV pilus minor pilin ComGF | - |
| BAMY6639_RS03000 (BAMY6639_03165) | comGE | 670576..670890 (-) | 315 | WP_060674611.1 | competence type IV pilus minor pilin ComGE | - |
| BAMY6639_RS03005 (BAMY6639_03170) | comGD | 670874..671311 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=112943 BAMY6639_RS02955 WP_003153105.1 666258..666431(+) (sinI) [Bacillus amyloliquefaciens UMAF6639]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=112943 BAMY6639_RS02955 WP_003153105.1 666258..666431(+) (sinI) [Bacillus amyloliquefaciens UMAF6639]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |