Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   FQT45_RS04175 Genome accession   NZ_LR595858
Coordinates   847074..847565 (+) Length   163 a.a.
NCBI ID   WP_077323239.1    Uniprot ID   A0A4U9XK39
Organism   Streptococcus pseudoporcinus strain NCTC10228     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 824934..879200 847074..847565 within 0


Gene organization within MGE regions


Location: 824934..879200
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQT45_RS04045 (NCTC10228_00826) - 824934..825323 (-) 390 WP_077323457.1 hypothetical protein -
  FQT45_RS04050 (NCTC10228_00827) - 825434..826222 (+) 789 WP_077323456.1 glycerophosphodiester phosphodiesterase -
  FQT45_RS04055 (NCTC10228_00828) - 826238..827764 (-) 1527 WP_077323627.1 IS1182 family transposase -
  FQT45_RS04060 (NCTC10228_00829) - 827865..828248 (-) 384 WP_077323609.1 hypothetical protein -
  FQT45_RS04065 (NCTC10228_00830) - 828266..829132 (-) 867 WP_077323608.1 metallophosphoesterase -
  FQT45_RS04070 (NCTC10228_00831) - 829201..829839 (+) 639 WP_077323607.1 HAD family hydrolase -
  FQT45_RS04075 (NCTC10228_00832) - 830004..831920 (+) 1917 WP_077323606.1 fructose-1,6-bisphosphatase -
  FQT45_RS04080 (NCTC10228_00833) queG 832033..833151 (+) 1119 WP_077323610.1 tRNA epoxyqueuosine(34) reductase QueG -
  FQT45_RS04085 (NCTC10228_00834) prfB 833201..834302 (+) 1102 WP_100068853.1 peptide chain release factor 2 -
  FQT45_RS04090 (NCTC10228_00835) ftsE 834334..835026 (+) 693 WP_007892765.1 cell division ATP-binding protein FtsE -
  FQT45_RS04095 (NCTC10228_00836) ftsX 835019..835948 (+) 930 WP_077323604.1 permease-like cell division protein FtsX -
  FQT45_RS04100 (NCTC10228_00837) - 836454..837980 (+) 1527 WP_143880461.1 IS1182 family transposase -
  FQT45_RS04105 (NCTC10228_00838) - 838240..838437 (-) 198 Protein_746 MBL fold metallo-hydrolase -
  FQT45_RS04110 (NCTC10228_00839) - 838470..839924 (-) 1455 WP_077323227.1 recombinase family protein -
  FQT45_RS04115 (NCTC10228_00840) - 840054..840863 (-) 810 WP_077323228.1 hypothetical protein -
  FQT45_RS04120 (NCTC10228_00841) - 840875..841615 (-) 741 WP_077323229.1 helix-turn-helix domain-containing protein -
  FQT45_RS04125 (NCTC10228_00842) - 841775..841987 (+) 213 WP_077323230.1 helix-turn-helix domain-containing protein -
  FQT45_RS04130 (NCTC10228_00843) - 842038..842769 (+) 732 WP_077323231.1 phage antirepressor KilAC domain-containing protein -
  FQT45_RS10435 (NCTC10228_00844) - 842845..843003 (+) 159 WP_172604974.1 BOW99_gp33 family protein -
  FQT45_RS04135 (NCTC10228_00845) - 843014..843379 (+) 366 WP_077323232.1 winged helix-turn-helix domain-containing protein -
  FQT45_RS04140 (NCTC10228_00847) - 843618..843881 (+) 264 WP_077323233.1 hypothetical protein -
  FQT45_RS04145 (NCTC10228_00848) - 843881..844138 (+) 258 WP_077323234.1 hypothetical protein -
  FQT45_RS10440 (NCTC10228_00849) - 844148..844291 (+) 144 WP_172604975.1 hypothetical protein -
  FQT45_RS10750 (NCTC10228_00850) - 844302..844433 (+) 132 WP_257617288.1 hypothetical protein -
  FQT45_RS04150 (NCTC10228_00851) - 844437..844616 (+) 180 WP_000373551.1 hypothetical protein -
  FQT45_RS04155 (NCTC10228_00852) bet 844613..845392 (+) 780 WP_077323235.1 phage recombination protein Bet -
  FQT45_RS04160 (NCTC10228_00853) - 845402..846454 (+) 1053 WP_077323236.1 DUF1351 domain-containing protein -
  FQT45_RS04165 (NCTC10228_00854) - 846444..846767 (+) 324 WP_077323237.1 hypothetical protein -
  FQT45_RS04170 (NCTC10228_00855) - 846760..847077 (+) 318 WP_077323238.1 hypothetical protein -
  FQT45_RS04175 (NCTC10228_00856) ssb 847074..847565 (+) 492 WP_077323239.1 single-stranded DNA-binding protein Machinery gene
  FQT45_RS04180 (NCTC10228_00857) - 847574..848374 (+) 801 WP_077323240.1 DNA methyltransferase -
  FQT45_RS04185 (NCTC10228_00858) - 848364..848693 (+) 330 WP_077323241.1 hypothetical protein -
  FQT45_RS04190 (NCTC10228_00859) - 848690..849118 (+) 429 WP_077323242.1 RusA family crossover junction endodeoxyribonuclease -
  FQT45_RS04195 (NCTC10228_00860) - 849106..849420 (+) 315 WP_077323243.1 DUF1372 family protein -
  FQT45_RS04200 (NCTC10228_00861) - 849422..849853 (+) 432 WP_077323244.1 hypothetical protein -
  FQT45_RS04205 (NCTC10228_00862) - 849864..850109 (+) 246 WP_077323245.1 hypothetical protein -
  FQT45_RS04210 (NCTC10228_00863) - 850106..850423 (+) 318 WP_077323246.1 hypothetical protein -
  FQT45_RS04215 (NCTC10228_00864) - 850498..850914 (+) 417 WP_077323247.1 DUF1492 domain-containing protein -
  FQT45_RS04220 (NCTC10228_00865) terS 851075..851791 (+) 717 WP_077323248.1 phage terminase small subunit -
  FQT45_RS04225 (NCTC10228_00866) - 851760..853058 (+) 1299 WP_077323249.1 PBSX family phage terminase large subunit -
  FQT45_RS04230 (NCTC10228_00867) - 853070..854581 (+) 1512 WP_306341345.1 phage portal protein -
  FQT45_RS10445 (NCTC10228_00868) - 854586..856376 (+) 1791 WP_077323251.1 phage minor capsid protein -
  FQT45_RS04240 (NCTC10228_00869) - 856379..856561 (+) 183 WP_077323252.1 hypothetical protein -
  FQT45_RS04245 (NCTC10228_00870) - 856595..856825 (+) 231 WP_077323253.1 hypothetical protein -
  FQT45_RS04250 (NCTC10228_00871) - 856977..857540 (+) 564 WP_077323254.1 phage scaffolding protein -
  FQT45_RS04255 (NCTC10228_00872) - 857559..858428 (+) 870 WP_077323255.1 capsid protein -
  FQT45_RS10450 (NCTC10228_00873) - 858443..858601 (+) 159 WP_172604976.1 hypothetical protein -
  FQT45_RS04260 (NCTC10228_00874) - 858607..858807 (+) 201 WP_077323256.1 hypothetical protein -
  FQT45_RS04265 (NCTC10228_00875) - 858823..859230 (+) 408 WP_077323257.1 hypothetical protein -
  FQT45_RS04270 (NCTC10228_00876) - 859217..859558 (+) 342 WP_077323258.1 putative minor capsid protein -
  FQT45_RS04275 (NCTC10228_00877) - 859558..859920 (+) 363 WP_077323259.1 minor capsid protein -
  FQT45_RS04280 (NCTC10228_00878) - 859917..860318 (+) 402 WP_077323260.1 minor capsid protein -
  FQT45_RS04285 (NCTC10228_00879) - 860319..860774 (+) 456 WP_077323261.1 phage tail tube protein -
  FQT45_RS04290 (NCTC10228_00880) - 860832..861191 (+) 360 WP_077323262.1 hypothetical protein -
  FQT45_RS04295 (NCTC10228_00881) - 861193..861792 (+) 600 WP_077323263.1 Gp15 family bacteriophage protein -
  FQT45_RS04300 (NCTC10228_00882) - 861814..865389 (+) 3576 WP_142355114.1 tape measure protein -
  FQT45_RS04305 (NCTC10228_00883) - 865389..866885 (+) 1497 WP_077323264.1 distal tail protein Dit -
  FQT45_RS04310 (NCTC10228_00884) - 866889..870446 (+) 3558 WP_077323265.1 phage tail spike protein -
  FQT45_RS04315 (NCTC10228_00885) - 870448..872430 (+) 1983 WP_077323266.1 DUF859 domain-containing protein -
  FQT45_RS04320 (NCTC10228_00886) - 872443..872886 (+) 444 WP_077323267.1 DUF1366 domain-containing protein -
  FQT45_RS04325 (NCTC10228_00887) - 872867..873085 (+) 219 WP_077323268.1 hypothetical protein -
  FQT45_RS04330 (NCTC10228_00888) - 873089..873367 (+) 279 WP_077323269.1 hypothetical protein -
  FQT45_RS04335 (NCTC10228_00889) - 873372..873599 (+) 228 WP_077323270.1 phage holin -
  FQT45_RS04340 (NCTC10228_00891) - 873728..875173 (+) 1446 WP_077323271.1 peptidoglycan amidohydrolase family protein -
  FQT45_RS04345 (NCTC10228_00892) - 875271..875705 (-) 435 Protein_798 MBL fold metallo-hydrolase -
  FQT45_RS04350 (NCTC10228_00893) - 875765..876586 (-) 822 WP_077323272.1 alpha/beta hydrolase -
  FQT45_RS04355 (NCTC10228_00894) - 876738..879200 (+) 2463 WP_077323273.1 bifunctional DnaQ family exonuclease/ATP-dependent helicase -

Sequence


Protein


Download         Length: 163 a.a.        Molecular weight: 18028.73 Da        Isoelectric Point: 4.8838

>NTDB_id=1128483 FQT45_RS04175 WP_077323239.1 847074..847565(+) (ssb) [Streptococcus pseudoporcinus strain NCTC10228]
MINNVVLVGRMTKDAELRYTPSNVAVATFTLAVNRNRKNENGEREADFINCVIWRQAAENLANWAKKGSLIGIVGSIQTR
NYENQQGQRVYVTEVIANQFHMLESRNQQEQGNSFQNGNNSNSGNFYPGGSPQSEFAGGTQGGYNSPFGNSNPMDISDDD
LPF

Nucleotide


Download         Length: 492 bp        

>NTDB_id=1128483 FQT45_RS04175 WP_077323239.1 847074..847565(+) (ssb) [Streptococcus pseudoporcinus strain NCTC10228]
ATGATTAACAATGTAGTACTGGTTGGAAGAATGACCAAGGACGCAGAACTCAGGTACACACCCTCTAATGTGGCAGTGGC
AACGTTTACTCTTGCTGTAAACCGCAACCGTAAAAACGAAAATGGAGAACGTGAGGCTGATTTTATTAACTGTGTCATTT
GGAGACAAGCAGCTGAAAACTTGGCTAACTGGGCTAAAAAAGGCTCATTGATTGGGATTGTAGGTAGTATCCAAACTAGA
AACTACGAAAACCAGCAAGGCCAACGTGTTTATGTGACAGAGGTTATTGCTAATCAGTTTCACATGCTAGAAAGTCGTAA
TCAACAGGAACAAGGCAACTCTTTCCAAAATGGGAACAACTCAAACAGTGGCAATTTCTATCCTGGAGGTTCTCCACAGT
CTGAGTTTGCAGGCGGTACACAAGGAGGTTACAACTCTCCATTTGGGAACTCAAACCCAATGGACATCTCAGATGATGAT
TTGCCTTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A4U9XK39

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

57.471

100

0.613

  ssbA Bacillus subtilis subsp. subtilis str. 168

55.814

100

0.589

  ssbB Bacillus subtilis subsp. subtilis str. 168

52.212

69.325

0.362


Multiple sequence alignment