Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   M036_RS12130 Genome accession   NZ_CP005997
Coordinates   2358603..2358776 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis TO-A     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2353603..2363776
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M036_RS12115 (M036_12010) gcvT 2354402..2355490 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  M036_RS12120 (M036_12015) hepAA 2355932..2357605 (+) 1674 WP_003230203.1 SNF2-related protein -
  M036_RS12125 (M036_12020) yqhG 2357626..2358420 (+) 795 WP_003230200.1 YqhG family protein -
  M036_RS12130 (M036_12025) sinI 2358603..2358776 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  M036_RS12135 (M036_12030) sinR 2358810..2359145 (+) 336 WP_080287687.1 transcriptional regulator SinR Regulator
  M036_RS12140 (M036_12035) tasA 2359238..2360023 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  M036_RS12145 (M036_12040) sipW 2360087..2360659 (-) 573 WP_003230181.1 signal peptidase I SipW -
  M036_RS12150 (M036_12045) tapA 2360643..2361404 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  M036_RS12155 (M036_12050) yqzG 2361676..2362002 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  M036_RS12160 (M036_12055) spoIITA 2362044..2362223 (-) 180 WP_003230176.1 YqzE family protein -
  M036_RS12165 (M036_12060) comGG 2362294..2362668 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  M036_RS12170 (M036_12065) comGF 2362669..2363052 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  M036_RS12175 (M036_12070) comGE 2363078..2363425 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=112820 M036_RS12130 WP_003230187.1 2358603..2358776(+) (sinI) [Bacillus subtilis TO-A]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=112820 M036_RS12130 WP_003230187.1 2358603..2358776(+) (sinI) [Bacillus subtilis TO-A]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment