Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   M036_RS12170 Genome accession   NZ_CP005997
Coordinates   2362669..2363052 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis TO-A     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2357669..2368052
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M036_RS12130 (M036_12025) sinI 2358603..2358776 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  M036_RS12135 (M036_12030) sinR 2358810..2359145 (+) 336 WP_080287687.1 transcriptional regulator SinR Regulator
  M036_RS12140 (M036_12035) tasA 2359238..2360023 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  M036_RS12145 (M036_12040) sipW 2360087..2360659 (-) 573 WP_003230181.1 signal peptidase I SipW -
  M036_RS12150 (M036_12045) tapA 2360643..2361404 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  M036_RS12155 (M036_12050) yqzG 2361676..2362002 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  M036_RS12160 (M036_12055) spoIITA 2362044..2362223 (-) 180 WP_003230176.1 YqzE family protein -
  M036_RS12165 (M036_12060) comGG 2362294..2362668 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  M036_RS12170 (M036_12065) comGF 2362669..2363052 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  M036_RS12175 (M036_12070) comGE 2363078..2363425 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  M036_RS12180 (M036_12075) comGD 2363409..2363840 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  M036_RS12185 (M036_12080) comGC 2363830..2364126 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  M036_RS12190 (M036_12085) comGB 2364140..2365177 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  M036_RS12195 (M036_12090) comGA 2365164..2366234 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  M036_RS22130 (M036_12100) - 2366445..2366570 (-) 126 WP_003230155.1 hypothetical protein -
  M036_RS12210 (M036_12105) corA 2366636..2367589 (-) 954 WP_032677123.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=112823 M036_RS12170 WP_003230168.1 2362669..2363052(-) (comGF) [Bacillus subtilis TO-A]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=112823 M036_RS12170 WP_003230168.1 2362669..2363052(-) (comGF) [Bacillus subtilis TO-A]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment