Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   FGL23_RS10640 Genome accession   NZ_LR594049
Coordinates   2182219..2182371 (-) Length   50 a.a.
NCBI ID   WP_012131079.1    Uniprot ID   -
Organism   Streptococcus gordonii strain NCTC10231     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2159861..2183136 2182219..2182371 within 0


Gene organization within MGE regions


Location: 2159861..2183136
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGL23_RS10445 (NCTC10231_02092) mreC 2159861..2160676 (-) 816 WP_061602341.1 rod shape-determining protein MreC -
  FGL23_RS10555 (NCTC10231_02114) comR/comR2 2167581..2168063 (-) 483 WP_061604085.1 sigma-70 family RNA polymerase sigma factor Regulator
  FGL23_RS10570 (NCTC10231_02117) ftsH 2168588..2170570 (-) 1983 WP_061603315.1 ATP-dependent zinc metalloprotease FtsH -
  FGL23_RS10575 (NCTC10231_02118) hpt 2170589..2171131 (-) 543 WP_045504966.1 hypoxanthine phosphoribosyltransferase -
  FGL23_RS10580 (NCTC10231_02119) tilS 2171136..2172413 (-) 1278 WP_061603314.1 tRNA lysidine(34) synthetase TilS -
  FGL23_RS10585 (NCTC10231_02120) - 2172410..2173690 (-) 1281 WP_061603313.1 serine hydrolase -
  FGL23_RS10590 - 2173690..2173806 (-) 117 WP_012131072.1 SP_0009 family protein -
  FGL23_RS10595 (NCTC10231_02121) - 2173809..2174177 (-) 369 WP_012131073.1 FtsB family cell division protein -
  FGL23_RS10600 (NCTC10231_02122) - 2174170..2174436 (-) 267 WP_061603312.1 RNA-binding S4 domain-containing protein -
  FGL23_RS10605 (NCTC10231_02123) mfd 2174502..2178005 (-) 3504 WP_138115477.1 transcription-repair coupling factor -
  FGL23_RS10610 (NCTC10231_02124) pth 2177998..2178567 (-) 570 WP_061603311.1 aminoacyl-tRNA hydrolase -
  FGL23_RS10615 (NCTC10231_02125) ychF 2178641..2179756 (-) 1116 WP_008808030.1 redox-regulated ATPase YchF -
  FGL23_RS10630 (NCTC10231_02128) comE/comE2 2180078..2180845 (-) 768 WP_008808031.1 competence system response regulator transcription factor ComE Regulator
  FGL23_RS10635 (NCTC10231_02129) comD/comD1 2180842..2182203 (-) 1362 WP_061603310.1 competence system sensor histidine kinase ComD Regulator
  FGL23_RS10640 (NCTC10231_02130) comC/comC1 2182219..2182371 (-) 153 WP_012131079.1 bacteriocin Regulator
  FGL23_RS10650 (NCTC10231_02132) rlmH 2182657..2183136 (-) 480 WP_061603309.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -

Sequence

Protein


Download         Length: 50 a.a.        Molecular weight: 6146.21 Da        Isoelectric Point: 10.8831

>NTDB_id=1128014 FGL23_RS10640 WP_012131079.1 2182219..2182371(-) (comC/comC1) [Streptococcus gordonii strain NCTC10231]
MKKKNKQNLLPKELQQFEILTERKLEQVTGGDVRSNKIRLWWENIFFNKK

Nucleotide


Download         Length: 153 bp        

>NTDB_id=1128014 FGL23_RS10640 WP_012131079.1 2182219..2182371(-) (comC/comC1) [Streptococcus gordonii strain NCTC10231]
ATGAAAAAGAAAAACAAACAAAATCTATTGCCAAAAGAGTTACAACAATTTGAAATTTTGACAGAAAGAAAATTAGAGCA
AGTTACTGGTGGAGATGTTCGCTCAAACAAAATTAGATTATGGTGGGAAAATATATTCTTTAATAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus gordonii str. Challis substr. CH1

100

100

1
  comC/comC2 Streptococcus gordonii strain NCTC7865

74

100

0.74

Multiple sequence alignment