Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   E0F32_RS02485 Genome accession   NZ_LR216050
Coordinates   443982..444131 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 438982..449131
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E0F32_RS02435 (SAMEA3431333_00455) ccrZ 439175..439969 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  E0F32_RS02440 (SAMEA3431333_00456) - 440130..440741 (-) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  E0F32_RS02450 (SAMEA3431333_00457) blpZ 440892..441125 (-) 234 WP_000276498.1 immunity protein BlpZ -
  E0F32_RS02455 (SAMEA3431333_00458) - 441167..441856 (-) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  E0F32_RS02460 (SAMEA3431333_00459) - 441908..442291 (-) 384 WP_000877381.1 hypothetical protein -
  E0F32_RS12215 (SAMEA3431333_00460) - 442920..443278 (-) 359 Protein_467 immunity protein -
  E0F32_RS02480 - 443759..443878 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  E0F32_RS12350 - 443881..443946 (-) 66 Protein_469 ComC/BlpC family peptide pheromone/bacteriocin -
  E0F32_RS02485 cipB 443982..444131 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  E0F32_RS02495 (SAMEA3431333_00462) blpK 444375..444623 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  E0F32_RS02500 (SAMEA3431333_00463) blpJ 444692..444961 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  E0F32_RS02510 (SAMEA3431333_00464) blpI 445428..445625 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  E0F32_RS12220 (SAMEA3431333_00465) comA/nlmT 445914..446501 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  E0F32_RS02520 (SAMEA3431333_00466) comA/nlmT 446428..448071 (+) 1644 WP_078133412.1 peptide cleavage/export ABC transporter Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=1126098 E0F32_RS02485 WP_001809846.1 443982..444131(-) (cipB) [Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1126098 E0F32_RS02485 WP_001809846.1 443982..444131(-) (cipB) [Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531

Multiple sequence alignment