Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilA   Type   Machinery gene
Locus tag   ELZ64_RS01990 Genome accession   NZ_LR134169
Coordinates   442849..443295 (+) Length   148 a.a.
NCBI ID   WP_115586745.1    Uniprot ID   -
Organism   Actinobacillus lignieresii strain NCTC10568     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 440633..483841 442849..443295 within 0


Gene organization within MGE regions


Location: 440633..483841
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ELZ64_RS01980 (NCTC10568_00414) - 441011..441244 (+) 234 WP_115589814.1 YgjV family protein -
  ELZ64_RS01985 (NCTC10568_00415) radA 441288..442667 (-) 1380 WP_005601211.1 DNA repair protein RadA Machinery gene
  ELZ64_RS01990 (NCTC10568_00416) pilA 442849..443295 (+) 447 WP_115586745.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  ELZ64_RS01995 (NCTC10568_00417) pilB 443313..444707 (+) 1395 WP_126374476.1 GspE/PulE family protein Machinery gene
  ELZ64_RS02000 (NCTC10568_00418) pilC 444691..445893 (+) 1203 WP_115586747.1 type II secretion system F family protein Machinery gene
  ELZ64_RS02005 (NCTC10568_00419) - 445920..446558 (+) 639 WP_115587966.1 prepilin peptidase -
  ELZ64_RS02010 (NCTC10568_00420) coaE 446580..447218 (+) 639 WP_115586748.1 dephospho-CoA kinase -
  ELZ64_RS02015 (NCTC10568_00421) yacG 447200..447388 (+) 189 WP_115586749.1 DNA gyrase inhibitor YacG -
  ELZ64_RS02020 (NCTC10568_00422) holA 447457..448488 (-) 1032 WP_126374477.1 DNA polymerase III subunit delta -
  ELZ64_RS02025 (NCTC10568_00423) lptE 448597..449091 (-) 495 WP_115589829.1 LPS assembly lipoprotein LptE -
  ELZ64_RS02030 (NCTC10568_00424) leuS 449191..451776 (-) 2586 WP_126374478.1 leucine--tRNA ligase -
  ELZ64_RS11750 - 452238..452441 (-) 204 WP_241971178.1 excalibur calcium-binding domain-containing protein -
  ELZ64_RS02040 (NCTC10568_00426) pepE 453305..454009 (+) 705 WP_241971151.1 dipeptidase PepE -
  ELZ64_RS02045 (NCTC10568_00427) - 454260..454742 (-) 483 WP_115586754.1 hypothetical protein -
  ELZ64_RS02050 (NCTC10568_00428) serS 454872..456176 (-) 1305 WP_115586755.1 serine--tRNA ligase -
  ELZ64_RS02055 (NCTC10568_00429) smpB 456294..456773 (-) 480 WP_005601189.1 SsrA-binding protein SmpB -
  ELZ64_RS02060 (NCTC10568_00430) - 456907..458316 (-) 1410 WP_126374480.1 YcjX family protein -
  ELZ64_RS02065 (NCTC10568_00431) - 458383..459222 (+) 840 WP_126374481.1 CYTH domain-containing protein -
  ELZ64_RS02070 (NCTC10568_00432) - 459265..459714 (-) 450 WP_115586757.1 hypothetical protein -
  ELZ64_RS02075 (NCTC10568_00433) - 459711..459875 (-) 165 WP_115586758.1 YoaH family protein -
  ELZ64_RS02080 (NCTC10568_00434) truC 459877..460620 (-) 744 WP_126374482.1 tRNA pseudouridine(65) synthase TruC -
  ELZ64_RS02085 (NCTC10568_00435) - 460621..460932 (-) 312 WP_005623108.1 YqcC family protein -
  ELZ64_RS02090 (NCTC10568_00436) - 460935..461624 (-) 690 WP_172539922.1 Fic family protein -
  ELZ64_RS02095 (NCTC10568_00437) trpCF 461778..463187 (+) 1410 WP_126374483.1 bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF -
  ELZ64_RS02100 (NCTC10568_00438) mnmC 463403..465406 (+) 2004 WP_126374484.1 bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC -
  ELZ64_RS02105 (NCTC10568_00439) - 465702..467081 (-) 1380 WP_115586764.1 L-serine ammonia-lyase -
  ELZ64_RS02110 (NCTC10568_00440) - 467177..468406 (-) 1230 WP_126374485.1 serine/threonine transporter -
  ELZ64_RS02115 (NCTC10568_00441) - 468763..470358 (+) 1596 WP_126374486.1 ABC transporter substrate-binding protein -
  ELZ64_RS02120 (NCTC10568_00442) metF 470453..471334 (-) 882 WP_126374487.1 methylenetetrahydrofolate reductase -
  ELZ64_RS02125 (NCTC10568_00443) - 471553..472710 (+) 1158 WP_197718030.1 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase -
  ELZ64_RS02135 (NCTC10568_00444) - 472939..473658 (-) 720 WP_126374489.1 helix-turn-helix transcriptional regulator -
  ELZ64_RS02140 (NCTC10568_00445) - 473835..474113 (+) 279 WP_018652729.1 helix-turn-helix domain-containing protein -
  ELZ64_RS02145 (NCTC10568_00446) - 474158..476128 (+) 1971 WP_126374490.1 Mu transposase C-terminal domain-containing protein -
  ELZ64_RS02150 (NCTC10568_00447) - 476141..477022 (+) 882 WP_126374491.1 AAA family ATPase -
  ELZ64_RS02155 (NCTC10568_00448) - 477034..477231 (+) 198 WP_126374492.1 hypothetical protein -
  ELZ64_RS02160 (NCTC10568_00449) - 477228..477539 (+) 312 WP_126374493.1 hypothetical protein -
  ELZ64_RS02165 (NCTC10568_00450) - 477560..477847 (+) 288 WP_126374494.1 hypothetical protein -
  ELZ64_RS02170 (NCTC10568_00451) - 477819..478037 (+) 219 WP_039196660.1 hypothetical protein -
  ELZ64_RS02175 (NCTC10568_00452) - 478047..478664 (+) 618 WP_126374495.1 DUF3164 family protein -
  ELZ64_RS02180 (NCTC10568_00453) - 478735..478935 (+) 201 WP_126374496.1 hypothetical protein -
  ELZ64_RS11755 (NCTC10568_00454) - 478956..479192 (+) 237 WP_241971152.1 DUF2786 domain-containing protein -
  ELZ64_RS02185 - 479116..479649 (+) 534 WP_241971153.1 DUF2786 domain-containing protein -
  ELZ64_RS02190 (NCTC10568_00456) - 479639..480190 (+) 552 WP_126374497.1 DUF5420 family protein -
  ELZ64_RS02195 (NCTC10568_00457) - 480192..480431 (+) 240 WP_126374498.1 hypothetical protein -
  ELZ64_RS02200 (NCTC10568_00458) - 480504..481070 (+) 567 WP_126375511.1 hypothetical protein -
  ELZ64_RS02205 (NCTC10568_00459) - 481054..481482 (+) 429 WP_126374499.1 regulatory protein GemA -
  ELZ64_RS02210 (NCTC10568_00460) - 481691..481873 (+) 183 WP_126374500.1 hypothetical protein -
  ELZ64_RS02215 (NCTC10568_00461) - 481958..482335 (+) 378 WP_126374501.1 hypothetical protein -
  ELZ64_RS02220 (NCTC10568_00462) - 482454..482879 (+) 426 WP_126374502.1 Mor transcription activator family protein -
  ELZ64_RS02225 (NCTC10568_00463) - 482965..483510 (+) 546 WP_126374503.1 N-acetylmuramoyl-L-alanine amidase -
  ELZ64_RS02230 (NCTC10568_00464) - 483513..483734 (+) 222 WP_018652747.1 DUF2644 domain-containing protein -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 16038.46 Da        Isoelectric Point: 7.6257

>NTDB_id=1118695 ELZ64_RS01990 WP_115586745.1 442849..443295(+) (pilA) [Actinobacillus lignieresii strain NCTC10568]
MQKLSLIRPLTNAFTLIELMIVIAIIAILATVAIPSYNSYTQKAALSELLAASASYKTDVEICIYNTGDSKNCSGGQNGV
RKMTELRQAKYLNTITVEGGTITVTGKGNLQEYGYTMTPIHNGSTISWETKCKGEDLSLFPANFCVSN

Nucleotide


Download         Length: 447 bp        

>NTDB_id=1118695 ELZ64_RS01990 WP_115586745.1 442849..443295(+) (pilA) [Actinobacillus lignieresii strain NCTC10568]
ATGCAAAAACTAAGTCTTATTCGACCGCTTACTAACGCGTTTACTTTAATTGAATTGATGATCGTGATTGCGATTATTGC
CATTTTAGCTACGGTTGCGATTCCGTCATATAACAGTTATACCCAAAAAGCGGCGCTTTCGGAGCTATTGGCGGCATCGG
CTTCTTATAAAACGGATGTCGAGATCTGCATATATAACACCGGAGATTCTAAAAACTGTAGCGGCGGTCAAAACGGTGTC
AGAAAAATGACGGAGCTTAGACAGGCTAAATATTTAAATACCATTACGGTGGAAGGCGGAACGATTACGGTAACGGGGAA
AGGGAATCTACAGGAATACGGTTATACGATGACACCGATTCATAACGGTAGCACTATTTCTTGGGAAACGAAATGTAAAG
GGGAGGACTTAAGTTTATTTCCGGCAAATTTCTGCGTATCAAATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilA Glaesserella parasuis strain SC1401

68.919

100

0.689

  pilA Haemophilus influenzae 86-028NP

55.102

99.324

0.547

  pilA Haemophilus influenzae Rd KW20

53.061

99.324

0.527


Multiple sequence alignment