Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQB47_RS02745 | Genome accession | NZ_LR129844 |
| Coordinates | 496377..496526 (+) | Length | 49 a.a. |
| NCBI ID | WP_001808912.1 | Uniprot ID | A0A4J1ZTW6 |
| Organism | Streptococcus pneumoniae strain 180-15 isolate 180-15 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 485887..495431 | 496377..496526 | flank | 946 |
Gene organization within MGE regions
Location: 485887..496526
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB47_RS02675 | - | 485887..486174 (-) | 288 | WP_000777760.1 | hypothetical protein | - |
| EQB47_RS02680 | - | 486184..486594 (-) | 411 | WP_001278301.1 | HIT family protein | - |
| EQB47_RS02685 | pptA | 486662..487393 (+) | 732 | WP_000889923.1 | ABC transporter ATP-binding protein | Regulator |
| EQB47_RS02690 | - | 487390..488439 (+) | 1050 | WP_000653752.1 | ABC transporter permease | - |
| EQB47_RS02695 | - | 488607..488936 (-) | 330 | WP_000132570.1 | hypothetical protein | - |
| EQB47_RS02700 | - | 489212..489550 (+) | 339 | WP_000682119.1 | LytTR family DNA-binding domain-containing protein | - |
| EQB47_RS02705 | comE/blpR | 489555..490292 (+) | 738 | WP_001219127.1 | response regulator transcription factor | Regulator |
| EQB47_RS02710 | - | 490306..491646 (+) | 1341 | WP_001017622.1 | sensor histidine kinase | - |
| EQB47_RS02715 | blpC | 491688..491843 (-) | 156 | WP_000358813.1 | quorum-sensing system pheromone BlpC | - |
| EQB47_RS02720 | - | 491900..493261 (-) | 1362 | WP_001069092.1 | bacteriocin secretion accessory protein | - |
| EQB47_RS11975 | comA/nlmT | 493272..493760 (-) | 489 | WP_307774349.1 | ATP-binding cassette domain-containing protein | Regulator |
| EQB47_RS11980 | comA/nlmT | 493744..494184 (-) | 441 | WP_001808911.1 | ATP-binding cassette domain-containing protein | Regulator |
| EQB47_RS11985 | comA/nlmT | 494174..494899 (-) | 726 | WP_167750760.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| EQB47_RS11990 | comA/nlmT | 494844..495431 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| EQB47_RS02735 | blpI | 495713..495910 (+) | 198 | WP_001093258.1 | bacteriocin-like peptide BlpI | - |
| EQB47_RS02745 | cipB | 496377..496526 (+) | 150 | WP_001808912.1 | bacteriocin-like peptide BlpO | Regulator |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.86 Da Isoelectric Point: 3.7098
>NTDB_id=1116414 EQB47_RS02745 WP_001808912.1 496377..496526(+) (cipB) [Streptococcus pneumoniae strain 180-15 isolate 180-15]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=1116414 EQB47_RS02745 WP_001808912.1 496377..496526(+) (cipB) [Streptococcus pneumoniae strain 180-15 isolate 180-15]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |