Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   EQB47_RS02745 Genome accession   NZ_LR129844
Coordinates   496377..496526 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   A0A4J1ZTW6
Organism   Streptococcus pneumoniae strain 180-15 isolate 180-15     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 485887..495431 496377..496526 flank 946


Gene organization within MGE regions


Location: 485887..496526
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQB47_RS02675 - 485887..486174 (-) 288 WP_000777760.1 hypothetical protein -
  EQB47_RS02680 - 486184..486594 (-) 411 WP_001278301.1 HIT family protein -
  EQB47_RS02685 pptA 486662..487393 (+) 732 WP_000889923.1 ABC transporter ATP-binding protein Regulator
  EQB47_RS02690 - 487390..488439 (+) 1050 WP_000653752.1 ABC transporter permease -
  EQB47_RS02695 - 488607..488936 (-) 330 WP_000132570.1 hypothetical protein -
  EQB47_RS02700 - 489212..489550 (+) 339 WP_000682119.1 LytTR family DNA-binding domain-containing protein -
  EQB47_RS02705 comE/blpR 489555..490292 (+) 738 WP_001219127.1 response regulator transcription factor Regulator
  EQB47_RS02710 - 490306..491646 (+) 1341 WP_001017622.1 sensor histidine kinase -
  EQB47_RS02715 blpC 491688..491843 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  EQB47_RS02720 - 491900..493261 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  EQB47_RS11975 comA/nlmT 493272..493760 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  EQB47_RS11980 comA/nlmT 493744..494184 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  EQB47_RS11985 comA/nlmT 494174..494899 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  EQB47_RS11990 comA/nlmT 494844..495431 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  EQB47_RS02735 blpI 495713..495910 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  EQB47_RS02745 cipB 496377..496526 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=1116414 EQB47_RS02745 WP_001808912.1 496377..496526(+) (cipB) [Streptococcus pneumoniae strain 180-15 isolate 180-15]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1116414 EQB47_RS02745 WP_001808912.1 496377..496526(+) (cipB) [Streptococcus pneumoniae strain 180-15 isolate 180-15]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A4J1ZTW6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment