Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAMMD1_RS11035 | Genome accession | NZ_LN999829 |
| Coordinates | 2391925..2392098 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain B25 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2386925..2397098
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAMMD1_RS11020 (BAMMD1_2217) | gcvT | 2387743..2388843 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAMMD1_RS11025 (BAMMD1_2219) | - | 2389266..2390936 (+) | 1671 | WP_058906183.1 | DEAD/DEAH box helicase | - |
| BAMMD1_RS11030 (BAMMD1_2220) | - | 2390954..2391748 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| BAMMD1_RS11035 (BAMMD1_2221) | sinI | 2391925..2392098 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BAMMD1_RS11040 (BAMMD1_2222) | sinR | 2392132..2392467 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAMMD1_RS11045 (BAMMD1_2223) | tasA | 2392515..2393300 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| BAMMD1_RS11050 (BAMMD1_2224) | sipW | 2393364..2393948 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| BAMMD1_RS11055 (BAMMD1_2225) | tapA | 2393920..2394591 (-) | 672 | WP_058906184.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAMMD1_RS11060 (BAMMD1_2227) | - | 2394850..2395179 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| BAMMD1_RS11065 (BAMMD1_2228) | - | 2395219..2395398 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BAMMD1_RS11070 (BAMMD1_2229) | comGG | 2395455..2395832 (-) | 378 | WP_015388005.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAMMD1_RS11075 (BAMMD1_2230) | comGF | 2395833..2396228 (-) | 396 | WP_015388004.1 | competence type IV pilus minor pilin ComGF | - |
| BAMMD1_RS11080 (BAMMD1_2231) | comGE | 2396242..2396556 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BAMMD1_RS11085 (BAMMD1_2232) | comGD | 2396540..2396977 (-) | 438 | WP_060387053.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1115424 BAMMD1_RS11035 WP_003153105.1 2391925..2392098(+) (sinI) [Bacillus velezensis strain B25]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1115424 BAMMD1_RS11035 WP_003153105.1 2391925..2392098(+) (sinI) [Bacillus velezensis strain B25]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |