Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   VV28_RS12850 Genome accession   NZ_LN680001
Coordinates   2574522..2574905 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain BS34A     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2569522..2579905
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VV28_RS12810 (BS34A_26990) sinI 2570456..2570629 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  VV28_RS12815 (BS34A_27000) sinR 2570663..2570998 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  VV28_RS12820 (BS34A_27010) tasA 2571091..2571876 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  VV28_RS12825 (BS34A_27020) sipW 2571940..2572512 (-) 573 WP_003246088.1 signal peptidase I SipW -
  VV28_RS12830 (BS34A_27030) tapA 2572496..2573257 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  VV28_RS12835 (BS34A_27040) yqzG 2573529..2573855 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  VV28_RS12840 (BS34A_27050) spoIITA 2573897..2574076 (-) 180 WP_003230176.1 YqzE family protein -
  VV28_RS12845 (BS34A_27060) comGG 2574147..2574521 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  VV28_RS12850 (BS34A_27070) comGF 2574522..2574905 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  VV28_RS12855 (BS34A_27080) comGE 2574931..2575278 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  VV28_RS12860 (BS34A_27090) comGD 2575262..2575693 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  VV28_RS12865 (BS34A_27100) comGC 2575683..2575979 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  VV28_RS12870 (BS34A_27110) comGB 2575993..2577030 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  VV28_RS12875 (BS34A_27120) comGA 2577017..2578087 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  VV28_RS12880 (BS34A_27140) corA 2578499..2579452 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=1113872 VV28_RS12850 WP_003230168.1 2574522..2574905(-) (comGF) [Bacillus subtilis strain BS34A]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1113872 VV28_RS12850 WP_003230168.1 2574522..2574905(-) (comGF) [Bacillus subtilis strain BS34A]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment