Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   VV34_RS17435 Genome accession   NZ_LN649259
Coordinates   3293137..3293277 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BS49     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3288137..3298277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VV34_RS17410 (BS49_34820) yuxO 3288450..3288830 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  VV34_RS17415 (BS49_34830) comA 3288849..3289493 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  VV34_RS17420 (BS49_34840) comP 3289574..3291883 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  VV34_RS17425 (BS49_34850) comX 3291898..3292065 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  VV34_RS17430 (BS49_34860) comQ 3292053..3292952 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  VV34_RS17435 (BS49_34870) degQ 3293137..3293277 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  VV34_RS23795 - 3293499..3293624 (+) 126 WP_003228793.1 hypothetical protein -
  VV34_RS17440 (BS49_34880) - 3293738..3294106 (+) 369 WP_003243784.1 hypothetical protein -
  VV34_RS17445 (BS49_34890) pdeH 3294082..3295311 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  VV34_RS17450 (BS49_34900) pncB 3295448..3296920 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  VV34_RS17455 (BS49_34910) pncA 3296936..3297487 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  VV34_RS17460 (BS49_34920) yueI 3297584..3297982 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1113809 VV34_RS17435 WP_003220708.1 3293137..3293277(-) (degQ) [Bacillus subtilis strain BS49]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1113809 VV34_RS17435 WP_003220708.1 3293137..3293277(-) (degQ) [Bacillus subtilis strain BS49]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment