Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   VV34_RS17425 Genome accession   NZ_LN649259
Coordinates   3291898..3292065 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain BS49     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3286898..3297065
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VV34_RS17395 (BS49_34790) mrpE 3287293..3287769 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  VV34_RS17400 (BS49_34800) mrpF 3287769..3288053 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  VV34_RS17405 (BS49_34810) mnhG 3288037..3288411 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  VV34_RS17410 (BS49_34820) yuxO 3288450..3288830 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  VV34_RS17415 (BS49_34830) comA 3288849..3289493 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  VV34_RS17420 (BS49_34840) comP 3289574..3291883 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  VV34_RS17425 (BS49_34850) comX 3291898..3292065 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  VV34_RS17430 (BS49_34860) comQ 3292053..3292952 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  VV34_RS17435 (BS49_34870) degQ 3293137..3293277 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  VV34_RS23795 - 3293499..3293624 (+) 126 WP_003228793.1 hypothetical protein -
  VV34_RS17440 (BS49_34880) - 3293738..3294106 (+) 369 WP_003243784.1 hypothetical protein -
  VV34_RS17445 (BS49_34890) pdeH 3294082..3295311 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  VV34_RS17450 (BS49_34900) pncB 3295448..3296920 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1113807 VV34_RS17425 WP_003242801.1 3291898..3292065(-) (comX) [Bacillus subtilis strain BS49]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1113807 VV34_RS17425 WP_003242801.1 3291898..3292065(-) (comX) [Bacillus subtilis strain BS49]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment