Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   VV34_RS13505 Genome accession   NZ_LN649259
Coordinates   2570454..2570627 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BS49     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2565454..2575627
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VV34_RS13490 (BS49_26950) gcvT 2566253..2567341 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  VV34_RS13495 (BS49_26970) hepAA 2567783..2569456 (+) 1674 WP_004398544.1 SNF2-related protein -
  VV34_RS13500 (BS49_26980) yqhG 2569477..2570271 (+) 795 WP_003230200.1 YqhG family protein -
  VV34_RS13505 (BS49_26990) sinI 2570454..2570627 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  VV34_RS13510 (BS49_27000) sinR 2570661..2570996 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  VV34_RS13515 (BS49_27010) tasA 2571089..2571874 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  VV34_RS13520 (BS49_27020) sipW 2571938..2572510 (-) 573 WP_003246088.1 signal peptidase I SipW -
  VV34_RS13525 (BS49_27030) tapA 2572494..2573255 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  VV34_RS13530 (BS49_27040) yqzG 2573527..2573853 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  VV34_RS13535 (BS49_27050) spoIITA 2573895..2574074 (-) 180 WP_003230176.1 YqzE family protein -
  VV34_RS13540 (BS49_27060) comGG 2574145..2574519 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  VV34_RS13545 (BS49_27070) comGF 2574520..2574903 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  VV34_RS13550 (BS49_27080) comGE 2574929..2575276 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1113783 VV34_RS13505 WP_003230187.1 2570454..2570627(+) (sinI) [Bacillus subtilis strain BS49]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1113783 VV34_RS13505 WP_003230187.1 2570454..2570627(+) (sinI) [Bacillus subtilis strain BS49]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment