Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   ACNR93_RS08305 Genome accession   NZ_CP184736
Coordinates   1682945..1683097 (+) Length   50 a.a.
NCBI ID   WP_420543561.1    Uniprot ID   -
Organism   Streptococcus equinus strain NM-2-29     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Genomic Context

Location: 1677945..1688097
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNR93_RS08275 (ACNR93_08275) comD/comD3 1678438..1679832 (-) 1395 WP_420543557.1 sensor histidine kinase Regulator
  ACNR93_RS08280 (ACNR93_08280) - 1679833..1680030 (-) 198 WP_126438119.1 hypothetical protein -
  ACNR93_RS08285 (ACNR93_08285) - 1680191..1680484 (-) 294 WP_039697859.1 bacteriocin immunity protein -
  ACNR93_RS08290 (ACNR93_08290) - 1680514..1680819 (-) 306 WP_420543558.1 bacteriocin immunity protein -
  ACNR93_RS08295 (ACNR93_08295) - 1680839..1681126 (-) 288 WP_420543559.1 DUF3884 family protein -
  ACNR93_RS08300 (ACNR93_08300) - 1681309..1682631 (-) 1323 WP_420543560.1 sensor histidine kinase -
  ACNR93_RS08305 (ACNR93_08305) comC/comC1 1682945..1683097 (+) 153 WP_420543561.1 hypothetical protein Regulator
  ACNR93_RS08310 (ACNR93_08310) comD/comD1 1683113..1684387 (-) 1275 WP_420543562.1 sensor histidine kinase Regulator
  ACNR93_RS08315 (ACNR93_08315) comE/comE1 1684446..1685177 (-) 732 WP_420543563.1 response regulator transcription factor Regulator
  ACNR93_RS08320 (ACNR93_08320) - 1685536..1685781 (-) 246 WP_074483823.1 DUF3884 family protein -
  ACNR93_RS08325 (ACNR93_08325) - 1685857..1686081 (-) 225 WP_094140014.1 helix-turn-helix domain-containing protein -
  ACNR93_RS08330 (ACNR93_08330) - 1686071..1687072 (-) 1002 WP_420543564.1 thioredoxin fold domain-containing protein -
  ACNR93_RS08335 (ACNR93_08335) - 1687233..1687535 (-) 303 WP_039697854.1 bacteriocin immunity protein -
  ACNR93_RS08340 (ACNR93_08340) - 1687547..1687786 (-) 240 WP_074615778.1 garvicin Q family class II bacteriocin -

Sequence

Protein


Download         Length: 50 a.a.        Molecular weight: 5695.41 Da        Isoelectric Point: 4.4013

>NTDB_id=1110969 ACNR93_RS08305 WP_420543561.1 1682945..1683097(+) (comC/comC1) [Streptococcus equinus strain NM-2-29]
MTEWKMSELESVKELTDSDLEKTVGGDNIPLLTGVGDWFNFFKGKTKDRT

Nucleotide


Download         Length: 153 bp        

>NTDB_id=1110969 ACNR93_RS08305 WP_420543561.1 1682945..1683097(+) (comC/comC1) [Streptococcus equinus strain NM-2-29]
ATGACAGAATGGAAAATGTCAGAGTTAGAATCAGTCAAAGAGTTGACTGATTCTGATTTGGAGAAGACAGTTGGAGGAGA
TAATATTCCTCTACTTACTGGTGTTGGTGATTGGTTTAATTTCTTTAAAGGAAAAACTAAAGACCGTACGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus equinus JB1

76

100

0.76

Multiple sequence alignment